DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14135 and Thap7

DIOPT Version :9

Sequence 1:NP_001261721.1 Gene:CG14135 / 39316 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_081185.1 Gene:Thap7 / 69009 MGIID:1916259 Length:309 Species:Mus musculus


Alignment Length:300 Identity:59/300 - (19%)
Similarity:117/300 - (39%) Gaps:65/300 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CAVKNCGNNNRIANRTKWRYFHFPKEKPNLQR--WIDFCQRDN------INPTTACI--CNEHFA 57
            |:...|...:....|.:...||...:|.|.:|  |:..|||.:      .:||:..|  |::||.
Mouse     5 CSAAGCCTRDTRETRNRGISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDPTSEYIYFCSKHFE 69

  Fly    58 PNDFERNMQYELGFSRKNPTKLKPGSFPSV----NGPQKLAK--------------ELRGSIKRG 104
            .|.||.     :|.|..:  :||.|:.|::    :..::.||              .||...||.
Mouse    70 ENCFEL-----VGISGYH--RLKEGAVPTIFESFSKLRRTAKTKGHGYPPGLPDVSRLRRCRKRC 127

  Fly   105 SK----SVPLAGSTKMSNIGFDPHHAGTQSS-EGHETIEIQLCGFN---TDIEGFEEAEDDDCPS 161
            |:    :.|.:...:...|.|....|...:: .....:.:. .|.|   :|:.|...|:.|:...
Mouse   128 SERQGPTTPFSPPPRADIICFPVEEASAPATLPASPAVRLD-PGLNSPFSDLLGPLGAQADEAGC 191

  Fly   162 GPRLVEVEILDPLNPQ-SNAKDHVEIIDSEGDSYV---------------KHLELEICSL---KR 207
            ..:....:...||.|| ::...::..:.....:|:               :..|..:.:|   :|
Mouse   192 STQPSPEQHPSPLEPQPASPSAYMLRLPPPAGAYIQNEHSYQVGSALLWKRRAEAALDALDKTQR 256

  Fly   208 EVFFLKDEYQKIKAEMRNLKDTIKRSEEELAEKQLQGVVK 247
            ::...|...|:::..:..|:.  :|:.|:.|:...:..:|
Mouse   257 QLQACKRREQRLRLRLTKLQQ--ERAREKRAQADARQTLK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 27/98 (28%)
GrpE 198..>239 CDD:295646 8/43 (19%)
Thap7NP_081185.1 THAP 4..93 CDD:214951 27/94 (29%)
PHA03247 <111..221 CDD:223021 19/110 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..210 8/33 (24%)
HCFC1-binding motif (HBM). /evidence=ECO:0000250 229..232 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.