DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14135 and Thap4

Sequence 1:NP_001261721.1 Gene:CG14135 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_080196.3 Gene:Thap4 MGIID:1914276 Length:569 Species:Mus musculus

Alignment Length:391 Identity:77/392 (20%)
Similarity:122/392 (31%) Gaps:166/392 (42%)


  Fly     3 CAVKNCGNNNRIANRTKWRYFHFP-KEKPNLQRWIDFCQRDNINPTT-ACICNEHFAPNDFERNM 65
            ||..||.|......:....:..|| |:...|.:|:...||||..||. :.:|:|||..:.|.:.:
Mouse     5 CAAVNCSNRQGKGEKRAVSFHRFPLKDSKRLIQWLKAVQRDNWTPTKYSFLCSEHFTKDSFSKRL 69

  Fly    66 --QYELGFSRKNPTKLKPGSFPSV--------------NGPQKLAKELRG--------------- 99
              |:.|         |||.:.||:              :..:|....:||               
Mouse    70 EDQHRL---------LKPTAVPSIFHLSEKKRGAGGHGHARRKTTAAMRGHTSAETGKGTIGSSL 125

  Fly   100 -------------SIKRGS-------KSVPLA-----GSTKMSNIGFDPH---HAGTQSSEGHET 136
                         .:||.|       |..|.|     |.:.....|.||.   ..|.:.::...|
Mouse   126 SSSDNLMAKPESRKLKRASPQDDAAPKVTPGAVSQEQGQSLEKTPGDDPAAPLARGQEEAQASAT 190

  Fly   137 -IEIQLCGFNTDIEGFEE---AEDDDCPSG--------------------------PRLVEVEIL 171
             .:.|....:||.||.::   :.||..|.|                          ||    |.:
Mouse   191 EADHQKASSSTDAEGADKSGISMDDFTPPGSGACKFIGSLHSYSFSSKHTRERPSVPR----EPM 251

  Fly   172 D------------------------------------PLNPQSNA--KDHVEIIDSE-GDSYVKH 197
            |                                    |..|.::.  |...|.:.|| .|:....
Mouse   252 DRKRLKREMEPRCSGNSVAQSPPSSSLTATPQKASQSPSAPPTDVTPKPAAEAVQSEHSDASPMS 316

  Fly   198 LELEI------CSL--------------KREVFFLKDEYQKIKAEMRNLKDTIKRSEEE---LAE 239
            :...|      |.|              |.:|..|:::.:|...|:::|:..:.||:.:   |.|
Mouse   317 INEVILSASGACKLIDSLHSYCFSARQNKSQVCCLREQVEKKNGELKSLRQKVSRSDSQVRKLRE 381

  Fly   240 K 240
            |
Mouse   382 K 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 28/103 (27%)
GrpE 198..>239 CDD:295646 12/64 (19%)
Thap4NP_080196.3 THAP 4..86 CDD:283206 28/90 (31%)
HCFC1-binding motif (HBM). {ECO:0000250} 230..233 0/3 (0%)
nitrobindin 414..566 CDD:143652
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002830
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.