DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14135 and thap4

Sequence 1:NP_001261721.1 Gene:CG14135 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001122208.1 Gene:thap4 ZFINID:ZDB-GENE-070912-5 Length:169 Species:Danio rerio

Alignment Length:159 Identity:37/160 (23%)
Similarity:58/160 (36%) Gaps:53/160 (33%)


  Fly    82 GSFPSVNGPQKLAKELRGSIKRGSKSVPLAGSTKMSNIGFDPHHAGTQSSEGHETIEIQLCGF-- 144
            |||||: .|.:..:.|..|    ....|:.      |..|:..||.::.....|      |||  
Zfish    33 GSFPSI-APFRYTETLHFS----HVGQPVV------NFMFNAFHAESKKPLHRE------CGFIR 80

  Fly   145 ---NTDIEGFEEAEDDDCPSGPRLVEVEILDPLNPQSNAKDHVEIIDSEGDSYVKHLELEICSLK 206
               .|:...|..|::    ||  |||:|                    ||:...:.|.|:..:|.
Zfish    81 LQPGTNRVAFIIAQN----SG--LVEIE--------------------EGELTGQQLTLQSTALA 119

  Fly   207 REVFFLKDEYQKIKAEMR-----NLKDTI 230
            |..|..:...|:|...::     .|:.|:
Zfish   120 RTSFAKQPHVQQISRHIQLRADGRLEQTV 148

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 5/6 (83%)
GrpE 198..>239 CDD:295646 9/39 (23%)
thap4NP_001122208.1 DUF1794 14..167 CDD:285921 37/160 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002830
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.