DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14135 and THAP4

Sequence 1:NP_001261721.1 Gene:CG14135 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_005247073.3 Gene:THAP4 HGNCID:23187 Length:711 Species:Homo sapiens

Alignment Length:217 Identity:50/218 (23%)
Similarity:78/218 (36%) Gaps:34/218 (16%)


  Fly     3 CAVKNCGNNNRIANRTKWRYFHFP-KEKPNLQRWIDFCQRDNINPTT-ACICNEHFAPNDFERNM 65
            ||..||.|......:....:..|| |:...|.:|:...||||..||. :.:|:|||..:.|.:.:
Human   112 CAAVNCSNRQGKGEKRAVSFHRFPLKDSKRLIQWLKAVQRDNWTPTKYSFLCSEHFTKDSFSKRL 176

  Fly    66 --QYELGFSRKNPTKLKPGSFPSV--------------NGPQKLAKELRGSIKRGSKSVPLAGST 114
              |:.|         |||.:.||:              ...:|.|.:..|.: ||..|    .:|
Human   177 EDQHRL---------LKPTAVPSIFHLTEKKRGAGGHGRTRRKDASKATGGV-RGHSS----AAT 227

  Fly   115 KMSNIGFDPHHAGTQSS--EGHETIEIQLCGFNTDIEGFEEAEDDDCPSGPRLVEVEILDPLNPQ 177
            .....|:.|..:|...:  |.....:..|.|..|.....|.|..:...........:.|..:...
Human   228 SRGAAGWSPSSSGNPMAKPESRRLKQAALQGEATPRAAQEAASQEQAQQALERTPGDGLATMVAG 292

  Fly   178 SNAKDHVEIIDSEGDSYVKHLE 199
            |..|......|:..:|....:|
Human   293 SQGKAEASATDAGDESATSSIE 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 28/103 (27%)
GrpE 198..>239 CDD:295646 1/3 (33%)
THAP4XP_005247073.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002830
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.