DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14135 and Thap4

Sequence 1:NP_001261721.1 Gene:CG14135 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001005564.1 Gene:Thap4 RGDID:1359473 Length:569 Species:Rattus norvegicus

Alignment Length:398 Identity:78/399 (20%)
Similarity:122/399 (31%) Gaps:180/399 (45%)


  Fly     3 CAVKNCGNNNRIANRTKWRYFHFP-KEKPNLQRWIDFCQRDNINPTT-ACICNEHFAPNDFERNM 65
            ||..||.|......:....:..|| |:...|.:|:...||||..||. :.:|:|||..:.|.:.:
  Rat     5 CAAVNCSNRQGKGEKRAVSFHRFPLKDSKRLIQWLKAVQRDNWTPTKYSFLCSEHFTKDSFSKRL 69

  Fly    66 --QYELGFSRKNPTKLKPGSFPSV------------NGP--QKLAKELRG--------------- 99
              |:.|         |||.:.||:            :||  :|....:||               
  Rat    70 EDQHRL---------LKPTAVPSIFHLSEKKRGAGGHGPARRKTTGAMRGHTSAATGKGTIGSSL 125

  Fly   100 ---------------------------------------SIKR--GSKSVPLA------------ 111
                                                   |::|  |.::.|||            
  Rat   126 SSSDNLMAKPESRKLKRASPQDDTAPKATPGAVSQEPGQSLERTPGDQAAPLARGQEEAQVSATE 190

  Fly   112 -----------------------------GSTKMSNIG------FDPHHAGTQSSEGHETIEIQL 141
                                         ||.....||      |...|...:.|...|.::.: 
  Rat   191 ADHQKASSSAADAGGADKSGISMDDFTPPGSGACKFIGSLHSYSFSSKHTRERPSVPREPMDRK- 254

  Fly   142 CGFNTDIE----GFEEAED-------------DDCPSGP----------RLVEVEILDPLNPQS- 178
             ....|||    |...|:.             ...||.|          ..|:.|..| .||.| 
  Rat   255 -RLKRDIEPRCSGNSVAQSPPSSSLTATPQKASQSPSAPPTDVTPKPAAEAVQSEHSD-ANPMSI 317

  Fly   179 -----NAKDHVEIIDSEGDSY---VKHLELEICSLKREVFFLKDEYQKIKAEMRNLKDTIKRSEE 235
                 :|....::|||. .||   .:..:.::|.|:.:|       :|...|:::|:..:.||:.
  Rat   318 NEVILSASGACKLIDSL-HSYCFSARQNKSQVCCLREQV-------EKKNGELKSLRQRVSRSDS 374

  Fly   236 E---LAEK 240
            :   |.||
  Rat   375 QVRKLREK 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 28/101 (28%)
GrpE 198..>239 CDD:295646 9/44 (20%)
Thap4NP_001005564.1 THAP 4..86 CDD:283206 28/90 (31%)
HCFC1-binding motif (HBM). {ECO:0000250} 230..233 0/3 (0%)
DUF1794 414..566 CDD:285921
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002830
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.