DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14135 and AgaP_AGAP005574

DIOPT Version :9

Sequence 1:NP_001261721.1 Gene:CG14135 / 39316 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_556220.3 Gene:AgaP_AGAP005574 / 3290002 VectorBaseID:AGAP005574 Length:580 Species:Anopheles gambiae


Alignment Length:285 Identity:63/285 - (22%)
Similarity:104/285 - (36%) Gaps:99/285 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CAVKNCGNNNRIANRTKWRY-FHF--PKEKPNLQRWIDFCQR--DNINPTTACICNEHFAPNDFE 62
            |:...|.||....||..... ||.  |....|:::||:||||  |.:....:.:|:.||..:||:
Mosquito     6 CSASFCKNNRYNVNRRGLDITFHTFPPLNYHNVRQWIEFCQREEDWLPNKHSVLCSAHFRDDDFQ 70

  Fly    63 RNMQYELGFSRKNPTKLKPGSFPSVNGPQKLAKELRGSIKRGSKSVP---LAGSTKMSNIGF--- 121
            .|          |...:|.|         |..:.|:|.......|.|   |:...|:..:..   
Mosquito    71 MN----------NCPIIKQG---------KRLRHLKGYAVPSVMSRPPITLSKRQKLDEVRIKLL 116

  Fly   122 ------DPHHAGTQSSEGHETIEIQLCGFNTDIEGFEEAEDDDCPSGPRLVEVEILDPLNPQSNA 180
                  |.|:.|   ||...|              :.||:.|         |....||||   ..
Mosquito   117 ANLYNKDEHNTG---SENDHT--------------YSEAKTD---------EPVQRDPLN---GC 152

  Fly   181 KDHVEIID------------SEGDSYVK-----HLELEICSLKREVFFLKDEY------QKIKAE 222
            |..:..:.            .|.||...     |..|| |::::::    ||.      |:.:::
Mosquito   153 KKSIYFLQRYPNVCAFCLRLMEDDSVFLPLGHFHDSLE-CTIEQKL----DEITGDPMDQEDRSD 212

  Fly   223 MRNLKDTIKRSEEELAEKQLQGVVK 247
            ::||      ..:::.|:.|:.::|
Mosquito   213 VQNL------LPDKVCEECLETLIK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 26/89 (29%)
GrpE 198..>239 CDD:295646 8/46 (17%)
AgaP_AGAP005574XP_556220.3 THAP 5..96 CDD:214951 29/108 (27%)
zf-AD 165..238 CDD:214871 15/78 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008566
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.