Sequence 1: | NP_001261721.1 | Gene: | CG14135 / 39316 | FlyBaseID: | FBgn0036193 | Length: | 259 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001100892.1 | Gene: | Thap11 / 307806 | RGDID: | 1310268 | Length: | 308 | Species: | Rattus norvegicus |
Alignment Length: | 305 | Identity: | 61/305 - (20%) |
---|---|---|---|
Similarity: | 102/305 - (33%) | Gaps: | 118/305 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 CAVKNCGNNNRIANRTKWRYFH-FPKEKPNLQRWIDFCQRDNIN-------PTTA-CICNEHFAP 58
Fly 59 NDFERNMQYELGFSRKNPTKLKPGSFP--SVNGPQKLAKELRGSI-------------------- 101
Fly 102 ---KRGSKSVPLAGSTKMSNI-----------------GFDPHHA-GT-----QSSEGHE----- 135
Fly 136 -TIEIQLCGFN--------TDIE----GFEEAEDDDCPSGPRLV--------------------- 166
Fly 167 --EVEILDPLNPQSNAKDHVEIIDSEGDSYVKHLELEICSLKREV 209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14135 | NP_001261721.1 | THAP | 2..88 | CDD:283206 | 25/95 (26%) |
GrpE | 198..>239 | CDD:295646 | 4/12 (33%) | ||
Thap11 | NP_001100892.1 | THAP | 5..81 | CDD:283206 | 23/90 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |