DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14135 and T28H10.2

Sequence 1:NP_001261721.1 Gene:CG14135 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_506136.2 Gene:T28H10.2 WormBaseID:WBGene00012143 Length:228 Species:Caenorhabditis elegans

Alignment Length:109 Identity:28/110 (25%)
Similarity:39/110 (35%) Gaps:45/110 (41%)


  Fly    30 PNLQRWID--------------FCQR-DNINPTTACICNEHFAPNDFERNMQYELGFS--RKNPT 77
            |:||:..|              .||| :.|.......|..  .|       :|||.|.  |.|| 
 Worm    16 PSLQQCFDSDGACASWVASDRGSCQRKEYIKKNCRKSCGN--CP-------RYELKFDTRRLNP- 70

  Fly    78 KLKP---------------GSFPSVNGPQ-KLAKELRGSIKRGS 105
            :|:|               .:||::  |. |..:|:..||..||
 Worm    71 QLQPIHQLVGRWKGEHTGKVTFPTI--PTFKYTEEVEISIPEGS 112

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 21/90 (23%)
GrpE 198..>239 CDD:295646
T28H10.2NP_506136.2 ShKT 21..56 CDD:214586 6/37 (16%)
DUF1794 72..225 CDD:285921 11/44 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002830
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.