DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIEalpha and gtf-2E1

DIOPT Version :8

Sequence 1:NP_524026.1 Gene:TfIIEalpha / 39313 FlyBaseID:FBgn0015828 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_503060.1 Gene:gtf-2E1 / 178502 WormBaseID:WBGene00013998 Length:433 Species:Caenorhabditis elegans

Alignment Length:455 Identity:116/456 (25%)
Similarity:220/456 (48%) Gaps:59/456 (13%)


  Fly     3 STSTAAANAAPAKTEVRYVTEVPSSLKQLARLVVRGFYSLEDALIIDMLVRNPCMKEDDIGELLR 67
            |:..|.:.::.|.||.:.|.|:|.:|..:..:||:.|:|.|..:|:..::|..|::|:::...::
 Worm     2 SSGPATSGSSSAHTETQVVDEIPEALNTILLMVVKNFFSSEHFIIVYHIMRAQCIREENLKARIQ 66

  Fly    68 FEKKQLRARITTLRTDKFIQIRLKMETGPDGKAQKVNYYFINYKTFVNVVKYKLDLMRKRMETEE 132
            |::|.||..:.:|:.:|.::.|...:...:.:...:.:|:|||:..:|||:||:|.||:::|:.|
 Worm    67 FDQKMLRQLLASLKAEKLVKERTITQKNENNRTVSIIFYYINYRAVLNVVRYKIDHMRQKLESRE 131

  Fly   133 RDATSRASFKCSSCSKTFTDLEADQLFDMATLEFRCTFCGSSVEEDSAAMPKKDSRLMLAHFNEQ 197
            :..|:||.::|.:|..::..||.:::.|..:....|..|...|..|...:|.:.:|..:|.||||
 Worm   132 QMDTNRAHYRCGACQSSYDMLEINRILDAESGRLICWRCHGDVLADETVVPSRTTRTAVARFNEQ 196

  Fly   198 LQPLYDLLREVEGIKLAPEVLEP--------------EPVDIDTIRGLNKPNATRPDGMAWSGEA 248
            :.||:..:..:.||:|||.:|||              :...:|...|.......:..|:|.|.:.
 Worm   197 MTPLFSHICALNGIQLAPHLLEPDITKYLEDDKELQLQQQQMDFTSGGGGGGRIQLGGVAHSYQN 261

  Fly   249 TRNQGFAVEETRVDVTIGGDDTSDAVIERKSRPIWMTESTVITDTDAADGAADAVQTASGSGHRN 313
            ..:..:...:. |.|.:..|.....|.|.|..|.|:.::.:                  |.|..:
 Worm   262 IASINYQNGDA-VFVDLNADINKGPVEEAKIMPEWLKDNAI------------------GGGEAS 307

  Fly   314 RKENEDIMSVLLQHEKQPGQKEPHMKGMRVGSS-------NANSSDSSDDEKDIENSKIPDVDFD 371
            ..|:     ||.|.:.:  ::|...|..|.|.|       ..:|.:|:.:.| ||......:..:
 Worm   308 HNEH-----VLDQAKTE--EEETSTKQRRYGPSLDYLKEIECSSEESAPNVK-IEEPPAKQIKME 364

  Fly   372 -------NYINSDSAEEDDDVPTVLVAGRPHPLDQLDDNLIA-QMTPQEKENYIHVYQQHYSHIF 428
                   ..:::|.:||:|   .:.||||..||.|:...::. :|:..|||:|..|.|..::..|
 Worm   365 VDEEAIKMEVDNDESEEED---LIHVAGRALPLSQITPRMVENEMSELEKESYCSVVQDLFAMFF 426

  Fly   429  428
             Worm   427  426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIIEalphaNP_524026.1 HTH 30..137 CDD:304362 31/107 (29%)
TFIIE 43..188 CDD:128804 39/145 (27%)
TFIIE-A_C 357..429 CDD:288386 22/81 (27%)
gtf-2E1NP_503060.1 HTH 34..136 CDD:304362 31/102 (30%)
TFIIE 41..188 CDD:128804 40/147 (27%)
TFIIE-A_C 344..426 CDD:288386 23/86 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C237291307
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H38062
Inparanoid 1 1.050 169 1.000 Inparanoid score I2732
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1343016at2759
OrthoFinder 1 1.000 FOG0002759
OrthoInspector 1 1.000 T475248
orthoMCL 1 0.900 OOG5_129458
Panther 1 1.100 LDO PTHR13097
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1464
TreeFam 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.