DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and CG14891

DIOPT Version :10

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_650560.1 Gene:CG14891 / 42013 FlyBaseID:FBgn0038445 Length:495 Species:Drosophila melanogaster


Alignment Length:449 Identity:93/449 - (20%)
Similarity:155/449 - (34%) Gaps:126/449 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 HPPPIH-----SIEQLMLDDRFLSRFFQYFSPYERRILAQVCIKWRDTLYRSPRYWSGLLPTLQC 332
            ||.|:.     |...|.:.|....:...|.|..||...|..|.:::                   
  Fly    99 HPTPVEESGTLSAYDLPITDDIWWKVLDYLSLNERLNFAASCERFQ------------------- 144

  Fly   333 RELRQMPGCDRGKLYNSLIRRGFHALGLVGASDEDALDVVHS-----FPLASKHVHSLSLRCSSI 392
                        .:|.....|..|.|.:     :|...:.|.     ..|:.||:|     |  :
  Fly   145 ------------AIYELDSHRINHVLNM-----KDVCTLTHRVIKRLMLLSGKHIH-----C--V 185

  Fly   393 SDRGLETLLDHLQSLFELELAGCNEVTEAGLWACLTPRIVSLSLADCINIADEAVGAVAQLLPSL 457
            :...|.....:|....:|....|..:||...:.      :|:|||...::.|.|.|.:     ::
  Fly   186 TGGPLHPNWPYLTEFVQLLGVSCPNLTELSFFK------ISVSLAHMTHLFDGANGLI-----NI 239

  Fly   458 YEFSLQAYHVTDAALGY----------------FSPKQSH------SLSILRLQSCWELTNHGIV 500
            ...||:..::.||.: |                ||.|...      ||.||.:..|.:|:...::
  Fly   240 TNISLRRCNLKDAHI-YCLQMLSKLKSLDIRENFSIKGDSLKSLPISLEILNVSGCVDLSPKCLI 303

  Fly   501 NIVHSLPHLTVLSLSGCSKLTDDGVEL------------IAENLQKLRALDLSWCPRI------T 547
            .:. :|.||..|...|..|...|. ||            :.|....:..:.|....|:      :
  Fly   304 QLA-ALSHLRELRCPGIVKFAKDN-ELYGRLAHYCPMLEVLELTDFMNVIQLGGLSRLHTLVIHS 366

  Fly   548 DASLEY---------IA--CDLNQLEELTLDRCVHITDIGVGYISTMLSLTALFLRWCSQVRDFG 601
            .|.|:|         ||  ..|..||.|.....:..|...:...|.:..|..|.|    ..::|.
  Fly   367 SAQLDYHVNNVLLTSIAESYSLRHLEILDSFGPMSDTSFDLSIFSQLKELRTLIL----HNQNFT 427

  Fly   602 LQHLCSMR---NLQVLSLAGCPLLTSSGLSSLIQ-LRHLQELELTNCPGASHELFDYLK 656
            ..||..::   .|:.|.|:|.|.|::..::.|.: |..|:.|::..||..:.:|...|:
  Fly   428 TLHLMGLQKLSTLEFLDLSGSPNLSNEVVAKLTKSLSGLRRLKVDFCPLITRQLTKILE 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 F-box_FBXL16 283..325 CDD:438899 8/41 (20%)
leucine-rich repeat 382..406 CDD:275381 4/23 (17%)
AMN1 383..600 CDD:187754 55/267 (21%)
leucine-rich repeat 431..456 CDD:275381 7/24 (29%)
leucine-rich repeat 457..482 CDD:275381 8/46 (17%)
leucine-rich repeat 483..508 CDD:275381 6/24 (25%)
leucine-rich repeat 509..534 CDD:275381 8/36 (22%)
leucine-rich repeat 535..560 CDD:275381 8/41 (20%)
leucine-rich repeat 561..585 CDD:275381 5/23 (22%)
leucine-rich repeat 586..610 CDD:275381 6/26 (23%)
leucine-rich repeat 636..661 CDD:275381 6/21 (29%)
CG14891NP_650560.1 RRM 41..92 CDD:214636
leucine-rich repeat 211..237 CDD:275381 9/31 (29%)
LRR <235..>463 CDD:443914 51/239 (21%)
leucine-rich repeat 239..262 CDD:275381 5/23 (22%)
leucine-rich repeat 263..285 CDD:275381 3/21 (14%)
leucine-rich repeat 286..338 CDD:275381 14/53 (26%)
leucine-rich repeat 339..387 CDD:275381 8/47 (17%)
leucine-rich repeat 388..415 CDD:275381 6/26 (23%)
leucine-rich repeat 416..439 CDD:275381 6/26 (23%)
leucine-rich repeat 440..465 CDD:275381 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.