DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6084 and CG2767

Sequence 1:NP_001261716.1 Gene:CG6084 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster

Alignment Length:321 Identity:135/322 (42%)
Similarity:192/322 (60%) Gaps:18/322 (6%)


  Fly    44 DGNEIPVIGLGTFNSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIKEGVVKREDL 108
            :|.::||||:||:.:...::..|:..|::|||||||.|.||.||..:|..::..:..|.||||:|
  Fly    11 NGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKREEL 75

  Fly   109 FITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKEGCD-LFPTDKDGKTLYSPVD 172
            ||.:|:....:||..|:..::.:|..|:|.|:||||:|.|.......| .|..||:|   ...||
  Fly    76 FIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEG---LMEVD 137

  Fly   173 ----YVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATIPPVTNQIECHPYLTQKKLIDFC 233
                :...|.|||.|||:||.||||||||::.|:.|:|:...|.|..||||.|.||.|:.|:|||
  Fly   138 VTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLVDFC 202

  Fly   234 KSKDITITAYSPLGSPNRPWAKAGD------PVILEEAKIKEIAAKKKKTPGQILIRYQVQRANI 292
            ||::||:||||||||.......||.      |.:::..::|||||...|||.|:|:|:.:.....
  Fly   203 KSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTGVS 267

  Fly   293 VIPKSVTKDRIESNFQVFDFELTPEEIEIIESFECNGRLVPLLNQYG---HPHHPFEKDEY 350
            .||||....|::.|..|||||||.||:..:.|.:.|.|:......:|   ||...| |::|
  Fly   268 AIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTF-KNQY 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6084NP_001261716.1 ARA1 38..316 CDD:223729 124/283 (44%)
Tas 45..>248 CDD:223739 96/208 (46%)
CG2767NP_649757.1 ARA1 5..302 CDD:223729 127/294 (43%)
Tas 10..297 CDD:223739 126/289 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11732
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1770
55.040

Return to query results.
Submit another query.