DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6163 and zgc:152938

Sequence 1:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001070756.1 Gene:zgc:152938 ZFINID:ZDB-GENE-061013-458 Length:292 Species:Danio rerio

Alignment Length:136 Identity:29/137 (21%)
Similarity:55/137 (40%) Gaps:24/137 (18%)


  Fly    13 LLKAIKKYPEIWDSNNKLHMCRSVTSPMWTEIAEQFGGHVPTVKLQSIWSQMKYHYHNLVHRQIL 77
            |:..:....|::|.|:..:........:|.||||:.|.||..||.:  |..::..|        :
Zfish    60 LISLVSDRRELFDQNHIDYKHIDKREALWQEIAEKIGFHVDDVKTK--WKNLRDTY--------I 114

  Fly    78 HKDRFN-----------TKWEHFEPMSFMYNITVAKIVGA---QSSGGSGGGTSSDAPSTATEAA 128
            .|.|.:           ..|:..:.|.|:...:..:.|.:   :|:...|.|:.|:...:.:..:
Zfish   115 RKKREDQCTGEQTPKKKKTWKFMKMMEFLATSSEQRRVHSSVKESADEVGDGSESEKSLSISVES 179

  Fly   129 TVGEEP 134
            .|..||
Zfish   180 AVSSEP 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738 21/96 (22%)
MADF 226..316 CDD:214738
zgc:152938NP_001070756.1 MADF_DNA_bdg 60..128 CDD:287510 18/78 (23%)
BESS 226..260 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.