DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6163 and Adf1

DIOPT Version :10

Sequence 1:NP_648460.1 Gene:CG6163 / 39274 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster


Alignment Length:125 Identity:31/125 - (24%)
Similarity:54/125 - (43%) Gaps:20/125 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 IIDAIKTRPSLWAGRQRSEKGQGQ-SRTSAVWKEAAMEMGLTPTLMQTRWSIIKQRYVDELQKER 290
            :|:|:|..|.::   .||...... .|.:..||:.|..:|:.......||..::.::..|::..:
  Fly    16 LIEAVKLNPVIY---DRSHYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKLCQ 77

  Fly   291 HAQYSHQSFRSTWEHFDRMSFM-------REILLKKVDEREQTREQIQEIVSEQQHHQQT 343
                     .|.|.:|.:|.|:       ||.||.|.....|:..|:.:...:||..|||
  Fly    78 ---------ESRWRYFKQMQFLVDSIRQYRESLLGKCANGSQSANQVADPSQQQQAQQQT 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6163NP_648460.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 21/96 (22%)
Adf1NP_001260730.1 MADF 15..95 CDD:214738 19/90 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.