DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6163 and CG11504

Sequence 1:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_651758.1 Gene:CG11504 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster

Alignment Length:293 Identity:60/294 (20%)
Similarity:104/294 (35%) Gaps:77/294 (26%)


  Fly    10 RAQLLKAIKKYPE---IWDSNNKLHMCRSVTSPMWTEIAEQFGGHVPTVKLQSIWSQMKYHYHNL 71
            |.:.|:.|.:|..   :||.....:..:.|...:..|:::..||::|..:|:..:..::..||..
  Fly     5 REKTLQLISEYRSRRGLWDMTCDEYRKKDVKQRLLNEVSQVLGGNIPINELEKKFHTLRTQYHRE 69

  Fly    72 VHRQILHKDRFNTKWEHFEPMSFMYN---------------------ITVAKIVGAQSSGGS--- 112
            :.| :..|:.:|:||..|:.:.|:.:                     ..:.::....:|..|   
  Fly    70 ISR-MKRKEPYNSKWFGFKNLVFLSSPYACRSTKGRLKADLQGDERKFVLGEVTADHNSDSSTPA 133

  Fly   113 --GGGTSSD----------APSTATEAATVGEEPAAPVAPPPLPTATHGRGRP------SGSFSW 159
              ...|:::          |.|.|.|...:.||....|..........|..:|      |..|..
  Fly   134 NHNSNTNANMNEEYLRKNHASSRAQELEKLIEETTKDVDDIDESELEEGEVKPKQAKEMSVRFVS 198

  Fly   160 L--QTATTPTAPQLPHLITQPPHSQGHGMTYTAFTGLVPPPATVASET-----VATPPRKLGRPS 217
            |  |..|.|.  :..|......|.||:.:...:|.         |:|:     ..||.:..| .|
  Fly   199 LNEQEETEPL--ENHHQTLMDLHHQGNAVEAVSFQ---------ANESGELHYQTTPTQSTG-SS 251

  Fly   218 SLHNSMRGRIIDAIKTRPSLWAGRQRSEKGQGQ 250
            |:| .|..|||..           ||.:...||
  Fly   252 SVH-VMPTRIIKI-----------QRRDTSSGQ 272

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738 20/110 (18%)
MADF 226..316 CDD:214738 7/26 (27%)
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 19/82 (23%)
CytochromB561_N 238..>409 CDD:286826 14/49 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.