DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6163 and CG6276

Sequence 1:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_650445.3 Gene:CG6276 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster

Alignment Length:189 Identity:37/190 (19%)
Similarity:65/190 (34%) Gaps:46/190 (24%)


  Fly   257 WKEAAMEMGLTPTLMQTRWSIIKQRYVDELQKERHAQYSHQSFRSTWEHFDRMSFMREILLKKVD 321
            |:|..:::...|.....:|:.::..:     :..:..|..:.....|.:||||.|:...|.||..
  Fly    61 WREVDLKLEKNPGASLAKWTNLRISF-----RREYTNYLEEKVPPCWSYFDRMFFLHPYLRKKHQ 120

  Fly   322 EREQTREQIQEIVSE--------QQHHQQT---------QHHPSQHLHHYRPPQPPAGLVEHAQD 369
            :.:....|:|:.::.        |:....|         |..||.|      ..|||..:::..|
  Fly   121 QPKSLDTQVQDALAHLSNLSSRMQRERSVTIPGSSSIGGQPTPSAH------QSPPAQQLDNYLD 179

  Fly   370 MPIGLVQHHHQEGHHPTL----AMHHPQ------HSQPIRRRVKHESDLEWDPFEMILH 418
                    :..|..|...    .|...|      |.|.....:|.|.:...|.:|...|
  Fly   180 --------YFDEAEHNNSELDDIMEEEQQRNSRYHGQLDGNDIKSECEEPVDDYEQEAH 230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 11/59 (19%)
CG6276NP_650445.3 MADF 32..116 CDD:214738 12/60 (20%)
BESS 431..465 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131192405
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.