DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6163 and hng2

Sequence 1:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_649837.1 Gene:hng2 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster

Alignment Length:127 Identity:28/128 (22%)
Similarity:52/128 (41%) Gaps:22/128 (17%)


  Fly   217 SSLHNSMRGRIIDAIKTRPSLWAGRQRSEKG-QGQSRTSAVWKEAAMEM-------------GLT 267
            |:|..||. ..|||:..|..:|   :||... ..:......|::...|:             .:.
  Fly    12 SNLRYSMY-EFIDAVHKRSIIW---ERSHPNFHNRELRDEAWQQIGHELCSNFDDSSEPEKQEIV 72

  Fly   268 PTLMQTRWSIIKQRYVDELQKERHAQYSHQSFRSTWEHFDRMSFMREILLKKVDEREQTREQ 329
            .||:: ||...:..|   |:..|..|...:..|:::.:...:||:..:..:..|:.|..:||
  Fly    73 KTLLK-RWKNTRDSY---LRVNRLRQSGEEVARASYIYEKELSFLLNVKAESEDDVESLKEQ 130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 20/104 (19%)
hng2NP_649837.1 MADF_DNA_bdg 21..113 CDD:287510 20/99 (20%)
BESS 216..250 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48642
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.