DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6163 and hng2

DIOPT Version :10

Sequence 1:NP_648460.1 Gene:CG6163 / 39274 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_649837.1 Gene:hng2 / 41056 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster


Alignment Length:127 Identity:28/127 - (22%)
Similarity:52/127 - (40%) Gaps:22/127 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 SSLHNSMRGRIIDAIKTRPSLWAGRQRSEKG-QGQSRTSAVWKEAAMEM-------------GLT 267
            |:|..||. ..|||:..|..:|   :||... ..:......|::...|:             .:.
  Fly    12 SNLRYSMY-EFIDAVHKRSIIW---ERSHPNFHNRELRDEAWQQIGHELCSNFDDSSEPEKQEIV 72

  Fly   268 PTLMQTRWSIIKQRYVDELQKERHAQYSHQSFRSTWEHFDRMSFMREILLKKVDEREQTREQ 329
            .||:: ||...:..|   |:..|..|...:..|:::.:...:||:..:..:..|:.|..:||
  Fly    73 KTLLK-RWKNTRDSY---LRVNRLRQSGEEVARASYIYEKELSFLLNVKAESEDDVESLKEQ 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6163NP_648460.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 20/103 (19%)
hng2NP_649837.1 MADF 20..116 CDD:214738 20/102 (20%)
BESS 216..250 CDD:460758
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.