DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6163 and Mes2

Sequence 1:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_730768.1 Gene:Mes2 FlyBaseID:FBgn0037207 Length:437 Species:Drosophila melanogaster

Alignment Length:184 Identity:41/185 (22%)
Similarity:72/185 (39%) Gaps:34/185 (18%)


  Fly   136 APVAPPPLPTATHGRGRPSGSFSWLQTATTPTAPQLPHLITQPPHSQGHGMTYTAFTGLVPPPAT 200
            |||: ..||||||       |...:..|....|     |..:|.              |.|.|..
  Fly     2 APVS-GCLPTATH-------SLQDMSAAAAAIA-----LDMKPK--------------LEPHPLA 39

  Fly   201 VASETVATPPRKLGRPSSLHNSMRGRIIDAIKTRPSLWAGRQRSEKGQGQSRTSAVWKEAAMEMG 265
            .|:   |.|.:|:.:....:.|.:.::|..:...|.||..|..:.||..:.:..| |:....|..
  Fly    40 AAT---AMPSQKIKKLVRRNASDKLKLIQMVHDNPILWDSRLPNFKGAEEEKNRA-WEHIGREFN 100

  Fly   266 LTPTLMQTRWSIIKQRYVDELQKERHAQYSHQSFRSTWEHFDRMSFMREILLKK 319
            .....:...:..:::.|..||   .|.:.....|:..|..::.|.|:|:::.::
  Fly   101 APGRRVARAFKSLRESYRREL---AHVKLMGNGFKPKWSLYEAMDFLRDVIRER 151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 19/90 (21%)
Mes2NP_730768.1 MADF 62..149 CDD:214738 19/91 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48395
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.