powered by:
Protein Alignment CG6163 and Mes2
DIOPT Version :9
| Sequence 1: | NP_001261709.1 |
Gene: | CG6163 / 39274 |
FlyBaseID: | FBgn0036155 |
Length: | 428 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_730768.1 |
Gene: | Mes2 / 40514 |
FlyBaseID: | FBgn0037207 |
Length: | 437 |
Species: | Drosophila melanogaster |
| Alignment Length: | 184 |
Identity: | 41/184 - (22%) |
| Similarity: | 72/184 - (39%) |
Gaps: | 34/184 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 136 APVAPPPLPTATHGRGRPSGSFSWLQTATTPTAPQLPHLITQPPHSQGHGMTYTAFTGLVPPPAT 200
|||: ..|||||| |...:..|....| |..:|. |.|.|..
Fly 2 APVS-GCLPTATH-------SLQDMSAAAAAIA-----LDMKPK--------------LEPHPLA 39
Fly 201 VASETVATPPRKLGRPSSLHNSMRGRIIDAIKTRPSLWAGRQRSEKGQGQSRTSAVWKEAAMEMG 265
.|: |.|.:|:.:....:.|.:.::|..:...|.||..|..:.||..:.:..| |:....|..
Fly 40 AAT---AMPSQKIKKLVRRNASDKLKLIQMVHDNPILWDSRLPNFKGAEEEKNRA-WEHIGREFN 100
Fly 266 LTPTLMQTRWSIIKQRYVDELQKERHAQYSHQSFRSTWEHFDRMSFMREILLKK 319
.....:...:..:::.|..|| .|.:.....|:..|..::.|.|:|:::.::
Fly 101 APGRRVARAFKSLRESYRREL---AHVKLMGNGFKPKWSLYEAMDFLRDVIRER 151
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG6163 | NP_001261709.1 |
MADF |
12..98 |
CDD:214738 |
|
| MADF |
226..316 |
CDD:214738 |
19/89 (21%) |
| Mes2 | NP_730768.1 |
MADF |
62..149 |
CDD:214738 |
19/90 (21%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C45438504 |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.