DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6163 and CG8765

Sequence 1:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_649141.1 Gene:CG8765 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster

Alignment Length:526 Identity:92/527 (17%)
Similarity:169/527 (32%) Gaps:151/527 (29%)


  Fly     1 MPKEDPFVNRAQLLKAIKKYPEIWDSNNKLHMCRSVTSPMWTEIAEQFGGHVPTVKLQSIWSQMK 65
            :|||      ..|:..:.:...:::..:..:....:....|.||....|.  ..|:.:|.|..|:
  Fly    36 IPKE------LILISLVSQEQSLYNPKHPHYRSTKIKDEKWLEIGSNVGW--SDVQCKSKWKAMR 92

  Fly    66 YHY-HNLVHRQILHKDRFNTKWEHFEPMSFMYNITVAKIVGAQSSGGSGGGTSSDAPSTATEAAT 129
            ..| ..|...:...|   ..||::|:.:.|:....:|:     :..|..|.||:.|..|.|    
  Fly    93 DQYCRELKRAKACSK---AVKWKYFKELDFLRPYALAR-----NYRGRSGQTSNGAVGTVT---- 145

  Fly   130 VGEEPAAPVAPPPLPTATHGRGRPSG---------------------SFSWLQTATTPTAPQLPH 173
                      |..||..|......|.                     |.|:...::|...|....
  Fly   146 ----------PLSLPMTTSFSSNSSSQNLNLSGSIKIEDASASTLLDSCSFSSPSSTDKKPAATF 200

  Fly   174 LIT----------------QPPHSQ-----------GHGMT-------YTAFTGLVPPP------ 198
            |.:                |..|||           |.|.|       .||.|..|...      
  Fly   201 LASHIGAVLQQQQQQQQHQQQMHSQPEANWNYLTDAGGGATPSIIVQCGTANTTTVVDTLYNEIV 265

  Fly   199 ----ATVASETVATPPRKLGRPSSLHNS---------------------MRGRIIDAIKTRPSLW 238
                |...|.:.||....:...|:.||.                     ....:|..|:....::
  Fly   266 DCVNAANQSSSAATITSNVSTTSAAHNQSTNAEEEDDDPIHTFLNMESYFEKELITLIQQEDMIY 330

  Fly   239 AGRQRSEKGQGQSRTSAVWKEAAMEMGLTPTLMQTRWSIIKQRYVDELQKERHAQYSHQSFRSTW 303
              ...:|..:.......||:|.|.::..:....:.:|..::.:|..|.::.|  ...|....|.|
  Fly   331 --NYGNENYRNAKLKMEVWEEIARKLKKSVKQCRLKWKALRDQYAREHKRLR--TLMHIDATSRW 391

  Fly   304 EHFDRMSFMREILLKKVDEREQTREQIQEIVSEQQHHQQTQHHPSQHLHHYRPPQPPAGLVEHAQ 368
            :|::.:||:::.:.:|..|.:   .|:..::.:....::.:.|.:|   .:.||.....|...:.
  Fly   392 KHYNSLSFLQKYIQQKTLESD---SQLSMLLPKNDPVRELEDHMTQ---SHSPPTQQITLESSSS 450

  Fly   369 DMPIGL---------------VQHHHQEGHHPTLAMHHPQHSQPIRRRVKHESDL---EWDPFEM 415
            :..:.|               .|...||..|.....|..|..|      :..|:|   .:|..::
  Fly   451 NSQLNLPTLPHLTGPHKAEQQQQQQQQEEQHQQQQQHQQQQQQ------QQASELCVATYDDMDI 509

  Fly   416 ILHVHG 421
            ..:::|
  Fly   510 ENYING 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738 16/87 (18%)
MADF 226..316 CDD:214738 17/90 (19%)
CG8765NP_649141.1 MADF 42..123 CDD:214738 16/86 (19%)
MADF 318..405 CDD:214738 17/91 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.