DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6163 and stwl

Sequence 1:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster

Alignment Length:419 Identity:76/420 (18%)
Similarity:135/420 (32%) Gaps:128/420 (30%)


  Fly     1 MPKEDPFVNRAQLLKAIKKYPEIWDSNNKLHMCRSVTSPM-------WTEIAEQFGGHVPTVKLQ 58
            :|.:.|  .:||.:..:::...:  |...:|..||.|||:       ...|.:...|.|...|:.
  Fly   341 LPIQKP--GQAQRMTRLQRRKSM--SLAAVHSVRSSTSPVKMTPVPRSQPINKPPSGPVQITKIS 401

  Fly    59 SIWSQMKYHYHNLVHRQI-------LHKDRFNTKWEHFEPMSFMYNITVAKIVGAQSSGGSGGGT 116
                    |..::..|..       :::::..|:.:.   .:.::..|...|...|.||      
  Fly   402 --------HRDDIFPRPAVPSGVVNINQNQLKTQQQQ---KTLIFPTTDEAIANPQGSG------ 449

  Fly   117 SSDAPSTATEAATVGEEPAAPVAPPPLPTATHGRGRPSGSFSWLQTATTP---TAPQLPHLITQP 178
                                       |......|||......:|....|   |.||.|      
  Fly   450 ---------------------------PPQRRSVGRPPKKLPMVQRIVAPETQTKPQSP------ 481

  Fly   179 PHSQGHGMTYTAFTGLVPPPATVASETVATPPRKLGRPSSLHNS-------MRGRIIDAIKTRPS 236
                    ..|....:..|.::|||..:.....|....:|:.:|       .:|...::|||..:
  Fly   482 --------INTKVLTIGKPTSSVASGNINNIAIKSNVVTSISSSTATTNTITKGTSNNSIKTTEN 538

  Fly   237 L----WAGRQRSEKGQGQSRTSAVWKEAAMEMGLTPTLMQTRWSIIKQRYVDELQ-KERHAQYSH 296
            :    ::....|.....::.|.|   ..|:...: ||......|:...:.:.:|: .||..|...
  Fly   539 VNVISYSPNSSSTSSSSKATTGA---SGAVITNI-PTTTTAGTSVPVGKSITQLKMTERGTQTGV 599

  Fly   297 QSFRSTWEHFDRMSFMREILLKKVDEREQTREQIQEIVSEQQHH--------------QQTQHHP 347
            |:      .|....|:           |..:.|:||:...|:.|              ..|....
  Fly   600 QN------PFSDNYFL-----------EMIKPQMQEMNPRQKMHFKKKVFQALMETFDDATDFPT 647

  Fly   348 SQHLHHYRPPQPPAGLVEHAQDMPIGLVQ 376
            |:.|.|:. ...|:|. ||..|..:.||:
  Fly   648 SKELQHFN-INTPSGF-EHITDPELRLVR 674

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738 15/100 (15%)
MADF 226..316 CDD:214738 17/95 (18%)
stwlNP_001261839.1 MADF 11..98 CDD:214738
BESS 604..637 CDD:281011 7/44 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.