DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6163 and CG6683

Sequence 1:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_648232.1 Gene:CG6683 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster

Alignment Length:213 Identity:44/214 (21%)
Similarity:71/214 (33%) Gaps:68/214 (32%)


  Fly   226 RIIDAIKTRPSLWAGRQRSEKGQG-QSRTSAVWKEAAMEMGLTPTLMQTRWS--IIKQRYVDELQ 287
            |:|:.::..|.|:....|:...:. :.|...:|...|..:....:...:||:  :.|||  .||.
  Fly     7 RLIELVRANPKLYERELRNAPYEAHKKRHPEIWSSIATSLNSEASACVSRWNHLVAKQR--RELA 69

  Fly   288 KERHAQYSHQSFRSTWEHFDRMSFMREILLKKVDEREQTREQIQEIVSEQQHHQQTQHHPSQHLH 352
            ||:..     ...|.|.....:.|:                         |||    |||..|.:
  Fly    70 KEKAG-----GTGSDWSLLPHLKFL-------------------------QHH----HHPINHRN 100

  Fly   353 H---YRPPQPPAGLVEHAQDMPIGLVQHHHQEGHHPTLAM--------HHPQHSQPIRRRVKHES 406
            .   .|.....:..|...:| |:       ||.....||:        .:|.|:.|:.:..|.  
  Fly   101 SGDLSRSTLKSSDEVNDDED-PL-------QEAMDEQLAVAGAAPAPPTNPAHATPVAQAEKR-- 155

  Fly   407 DLEWDPFEMILHVHGAGE 424
                  .|.:|  .|.||
  Fly   156 ------IEALL--EGLGE 165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 20/93 (22%)
CG6683NP_648232.1 MADF 7..94 CDD:214738 24/123 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.