DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6163 and Coop

Sequence 1:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001260776.1 Gene:Coop FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster

Alignment Length:313 Identity:59/314 (19%)
Similarity:98/314 (31%) Gaps:114/314 (36%)


  Fly   120 APSTATEAATVGEEPAAPVAPPPLPTATHGRGRPSGSFSWLQTATTPTAPQLPHLITQPPHSQGH 184
            |.:.::.||:||...||..|              :.||::..||..|.                 
  Fly     4 AYNASSSAASVGSASAAASA--------------TASFAFTNTAKLPI----------------- 37

  Fly   185 GMTYTAFTGLVPPPATVASETVATPPRKLGRPSSLHNSMRGRIIDAIKTRPSLWAGRQRSEKGQG 249
                               |||.                  |:|.|:..||.||.  :.:..||.
  Fly    38 -------------------ETVK------------------RLIAAVSRRPMLWL--RNNANGQK 63

  Fly   250 QSRTSAVWKEAAMEMGLTPTLMQTRWSIIKQRYVDELQKERHAQYSHQSFRSTWEHFDRMSFMRE 314
            :|..:.||.|...::.|...:.:.:|..::    |..:|............|:|..::.|.||..
  Fly    64 RSDITPVWFEVGQDVNLPADICRIKWGHLR----DNFRKVYIRNNLSNETPSSWRFYNDMRFMEP 124

  Fly   315 ILLKKVDEREQTREQIQEIVSEQQHHQQTQHHPSQHLHHYRPPQPPAGLVEHAQDMPI------- 372
            .:.:.:  ..|||             ..::.||..|.........|    :....|||       
  Fly   125 AVHENI--MRQTR-------------SSSKKHPPGHWTENNNVLGP----DKYDSMPIVATEPIC 170

  Fly   373 GLVQHHHQEGHHPTLA----------MHHPQH----SQPIRRRVKHESDLEWD 411
            .|...:..|.|.|:.:          ...|::    |:|.:|....|.|.::|
  Fly   171 ELSHSYDSELHQPSFSDISSFFEDRDCQPPENKRFKSEPSQREEDEEDDDDFD 223

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 22/90 (24%)
CoopNP_001260776.1 MADF 42..124 CDD:214738 22/88 (25%)
BESS 320..353 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.