DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6163 and brwl

Sequence 1:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_609298.1 Gene:brwl FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster

Alignment Length:296 Identity:51/297 (17%)
Similarity:81/297 (27%) Gaps:134/297 (45%)


  Fly   226 RIIDAIKTRPSL-------WAGRQRSEKGQGQSRTSAVWKEAAMEMGLTPTLMQTRWSIIK---Q 280
            |.::.::|...|       :..|...||         .|...:.|...:....:.||..::   .
  Fly    60 RFVNLVRTHKCLYDKKVPEYRNRDNQEK---------AWVLISKETRESVIHCKERWRNLRACLS 115

  Fly   281 RYVDELQKERHAQYSHQSFRSTWEHFDRMSFMREILLKKVDEREQTREQIQEIVSEQQH--HQQT 343
            ||:   :::..::..|:.:..| ||   |:|:...|....:..|............|||  ||..
  Fly   116 RYI---KQQSGSEPQHKPYYLT-EH---MAFLLPFLKSSRNSLEGNNSLATLYQMSQQHLQHQPF 173

  Fly   344 QHHPSQHL---HHY--------------------------------------------------- 354
            ..||:.|.   |.|                                                   
  Fly   174 LLHPALHATEEHKYCANTSINNNNNNNDVHNGESMEVLEMKYSISEKDDEETIDAFDPAVTNTLG 238

  Fly   355 --------------------RPPQ-------------PPAGLVE-----------HAQDMPIGLV 375
                                .|.:             |...|.|           |....|:   
  Fly   239 MNRTSSTPTRSSALQGGGGNSPARSDTASADSMKNFIPDVQLAETGSQLIYSDGGHGTPPPL--- 300

  Fly   376 QHHHQEGH-HP-TLAM-HHPQHSQP-IRRRVKHESD 407
             |:|...| || ||:| |||...:| ..:|:|.|.:
  Fly   301 -HYHPHSHPHPLTLSMDHHPASYEPGSTKRIKTECE 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 18/100 (18%)
brwlNP_609298.1 MADF 60..145 CDD:214738 19/101 (19%)
BESS 356..389 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48617
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.