DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6163 and CG11723

DIOPT Version :9

Sequence 1:NP_001261709.1 Gene:CG6163 / 39274 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001259906.1 Gene:CG11723 / 33388 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster


Alignment Length:282 Identity:55/282 - (19%)
Similarity:88/282 - (31%) Gaps:127/282 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 RIIDAIKTRPSLW-AGRQRSEKGQGQSRTSAVWKEAAMEMGLTPTLMQTRWSIIKQRY------- 282
            |:|..:..|..|| .....|.:.|          :||::......:||...||.|:|:       
  Fly     7 RLIQEVSKRRCLWDTNMSISYRNQ----------DAALQWASVAQIMQQDVSICKKRFKGMRDSY 61

  Fly   283 ---VDELQKERHAQYSHQSFRSTWEHFDRMSFMREIL----------------LKKVDEREQTR- 327
               |.::|::| .:.||      |.:|..:.|||:|.                .::.:..|.|| 
  Fly    62 RAEVRKIQQKR-IEMSH------WPYFRSLEFMRQIFDPEGLVPFPPEPFVMNTEQPEVFEPTRL 119

  Fly   328 -----------------EQIQEIVSEQQHHQQTQHHPSQHLHHYRPPQPP-------AGLVEHAQ 368
                             |.|::|..                   |.|..|       ..|::...
  Fly   120 VDFAIDLDLDNDDSVDFEIIEDIFK-------------------REPSVPQDSGSDKGSLIKPLD 165

  Fly   369 DMPIGLVQHHHQEGHHPTLAMHHPQHSQPI----------RRR---------------------- 401
            ....|  .|...:...|||.:|.|:|.|.:          |||                      
  Fly   166 SSSSG--AHRSDQDLSPTLPIHLPRHQQFLPRPPPPSKRGRRRKTSPSNDVPLLNGYASQASKST 228

  Fly   402 ----VKHESDLEWDPFEMILHV 419
                :|::|||.: ...|:.||
  Fly   229 TEPDLKNDSDLSF-LMSMMPHV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 25/100 (25%)
CG11723NP_001259906.1 MADF 7..91 CDD:214738 25/100 (25%)
BESS 236..270 CDD:281011 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448365
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.