DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6163 and CG8119

Sequence 1:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_573050.1 Gene:CG8119 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster

Alignment Length:133 Identity:28/134 (21%)
Similarity:53/134 (40%) Gaps:20/134 (15%)


  Fly   220 HNSMRGRIIDAIKTRPSLWAGRQRSEKGQGQSRTSAVWKEAAMEMGLTPTLMQTRWSIIKQRYVD 284
            :|.....::..|..|||:|..|.:....:.|....  |.:.:..:||.....:.||..::..|..
  Fly    11 NNLETNHLLREIALRPSIWDSRIKFSLRRPQIPID--WLDVSNAVGLGVDECKRRWKSLRNNYRT 73

  Fly   285 ELQKERHAQYSHQSFRSTWEHFDRMSFMREIL-LKKVDEREQTREQIQEIVSEQQHHQQTQHHPS 348
            ::         ||....:|.|..:|.|:|::. ..|.....:.|.|:::        .:...||.
  Fly    74 KI---------HQGNAWSWPHSKQMEFVRDVFPPHKPKTPARCRVQVKK--------SKLILHPQ 121

  Fly   349 QHL 351
            |:|
  Fly   122 QYL 124

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 20/90 (22%)
CG8119NP_573050.1 MADF 17..97 CDD:214738 20/91 (22%)
BESS 201..234 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.