DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6163 and CG45071

Sequence 1:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_730024.1 Gene:CG45071 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster

Alignment Length:449 Identity:79/450 (18%)
Similarity:139/450 (31%) Gaps:182/450 (40%)


  Fly     2 PKEDPFV-NRAQLLKAIKKYPEIWDSNNKLHMCRSVTSPMWTEIAEQFGGH-VPTVKLQSIWSQM 64
            ||:...| |..|.:..|::.|.||  |...|..::....||.|::   |.| :|.:.|::.|..:
  Fly     3 PKKSTIVLNVEQFIHDIEERPAIW--NRNFHCNKAFLEQMWDELS---GAHKLPKIVLKAKWKGL 62

  Fly    65 KYHYHNLVHRQILHKDR---------FNTKWEHF------------------EPMSFMY------ 96
            :.:: .:.:::|...|.         |.:||.|:                  :..||.:      
  Fly    63 RDNF-RVEYKRIPRADNGDFMVDPATFESKWLHYYALLFLTDHMRHRLPKNEQDQSFYFSQQSED 126

  Fly    97 --------NITVAKIVGAQSSGGSGGGTSSDAPSTATEAA------------------------- 128
                    ::|...|...|.|.........:|...|:||.                         
  Fly   127 CEKTVVEPDLTNGLIRRLQDSDEDYDEEEMEADGEASEATMEETMPTPPAAHQMNQVSTTPLATG 191

  Fly   129 ----------------------------------------------------TVGEEPAAPVAPP 141
                                                                .:.|.|||..:||
  Fly   192 ALRAQEEAHQHALIKAGLLRAQLMELEKEAEDLSRKPPPPQQMTSPVAPSLQVLVEPPAAHCSPP 256

  Fly   142 PLPTATHGRGRPSGSFSWLQTATTPTAPQLPHLITQPPHSQGHGMTYTAFTGLVPPP-------- 198
            |:.|.|..:.:..||.:.|..|||.:|..:          ..:|........:.|||        
  Fly   257 PMVTTTSAQVQQPGSAAVLAPATTTSASSV----------SSNGAPMGGKRSVSPPPLYNKAHHP 311

  Fly   199 -ATVASETVATPPRK--LGRPSSL-----------HNSMRGRIIDAIK-TRPSLWAGRQRSEKGQ 248
             ||:|:..:|...|.  .|..|::           |:...| :|.|:| .||.|  ....:..|.
  Fly   312 LATLAAAHLAAKDRNEDFGPTSAVGGNGDHLSFTQHSYANG-LIPALKLKRPRL--SEDSNFNGS 373

  Fly   249 GQSRTSAVWKE-----------------AAMEMGLTPTLMQTRWSIIKQRYVDELQKER 290
            ....|..|.::                 ||.::.:...:.:.   |.|:.|.::|::.:
  Fly   374 STMDTPLVPEDDDYHYLLSLHPYMKQLTAAQKLRIRTKIQKL---IFKELYKEDLEESK 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738 23/128 (18%)
MADF 226..316 CDD:214738 15/84 (18%)
CG45071NP_730024.1 MADF 14..106 CDD:214738 21/98 (21%)
BESS 384..418 CDD:281011 3/37 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.