DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6163 and madf-9

DIOPT Version :9

Sequence 1:NP_001261709.1 Gene:CG6163 / 39274 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_500389.2 Gene:madf-9 / 191167 WormBaseID:WBGene00022608 Length:333 Species:Caenorhabditis elegans


Alignment Length:388 Identity:81/388 - (20%)
Similarity:128/388 - (32%) Gaps:156/388 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KEDPFVNRAQLLKAIKKYPEIWDSNNKLHMCRSVTSPMWTEIAEQF---GGHVPT---------- 54
            :|.|..| .:|:..:|..|.::|.:::.:...|..:..|.||||..   ..||.|          
 Worm    44 EETPVFN-IRLIAEVKARPFLYDQSDEGYNLLSWRNSAWNEIAENLETTSEHVKTRWKTLRDRYK 107

  Fly    55 --------VKLQSIW---SQMKYHYHNLVHRQILHKDRFNTKWE----------HFEP----MSF 94
                    .|..|.|   ..:|:...:|..|   |.|..::...          |..|    |||
 Worm   108 KEEKKERVSKKASSWVFQRPLKFIQAHLKDR---HTDETDSNQSEPAVKPEPNGHVSPMEAAMSF 169

  Fly    95 MYNITVAKIVGAQSSGGSGGGTSSDAPSTATEAATV--------GEEPAAPVAPPPLPTATHGRG 151
            :.|..:.....::|||.:|...||.| |||:.|::.        ||  |:.:.|||||       
 Worm   170 IENELIRTQDSSKSSGSTGEMESSSA-STASSASSSKNTGTQEGGE--ASVITPPPLP------- 224

  Fly   152 RPSGSFSWLQTATTPTAPQLPHLITQPPHSQGHGMTYTAFTGLVPPPATVASETVATPPRKLGRP 216
                               :|..:|                   |.|:..:|.:...|       
 Worm   225 -------------------IPMAVT-------------------PSPSATSSASNGGP------- 244

  Fly   217 SSLHNSMRGRIIDAIKTRPSLWAGRQRSEKGQGQ----SRTSAVWKEAAMEMGLTPTLMQTRWSI 277
                         |:|        |.|....:|.    ||.:|....|::.:...|.|.|  |:.
 Worm   245 -------------AVK--------RSRVSITEGMTPVASRNAAAAAAASLGLSFFPGLSQ--WAT 286

  Fly   278 IKQRYVDELQKERHAQYSHQSFRSTWEHFDRMSFMREILLKKVDER--EQTREQIQEIVSEQQ 338
            .::...||:                   |.||.   .|.|.|:|.|  |..:.|:.:.:.:.|
 Worm   287 TREEEEDEI-------------------FARMI---SIKLSKLDARTKEVAKLQVLKAIFDAQ 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738 26/123 (21%)
MADF 226..316 CDD:214738 18/93 (19%)
madf-9NP_500389.2 MADF 52..136 CDD:214738 17/83 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156232
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.