DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6163 and madf-3

Sequence 1:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_494766.1 Gene:madf-3 WormBaseID:WBGene00019218 Length:312 Species:Caenorhabditis elegans

Alignment Length:141 Identity:29/142 (20%)
Similarity:64/142 (45%) Gaps:17/142 (12%)


  Fly   226 RIIDAIKTRPSLWAGRQRSEKGQGQSRTSAVWKEAAMEMGL--TPTLMQTRWSIIKQRYVDELQK 288
            |:|:|::....|:....|..:  .....:.||:.....:|.  .|.::..||..::.:|..|.:|
 Worm     9 RLIEAVRHSRCLFDNTDRQYR--NTEYKNRVWQRLVTVLGFDGDPRMLSARWKQLRDKYGKEKRK 71

  Fly   289 ERHAQYSHQSFRSTWEHFDRMSFMREILLKKVD----EREQT--REQIQEIVSEQQHHQQTQHHP 347
            ::   |.::  :|:|::|..:.|:...:..:.:    .:|.|  .|:|.|....:....:.:.||
 Worm    72 QK---YGNE--KSSWQYFKHLHFLDPHMTDRAEISPSRKEPTGVHEKIAEPCFGKNLILEVRRHP 131

  Fly   348 SQHLHHYRPPQ 358
            .  |:..|.|:
 Worm   132 C--LYDVRDPK 140

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 19/92 (21%)
madf-3NP_494766.1 MADF 9..94 CDD:214738 19/92 (21%)
MADF 122..212 CDD:214738 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.