DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6163 and madf-4

Sequence 1:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_505565.3 Gene:madf-4 WormBaseID:WBGene00011575 Length:329 Species:Caenorhabditis elegans

Alignment Length:178 Identity:32/179 (18%)
Similarity:63/179 (35%) Gaps:55/179 (31%)


  Fly     2 PKEDPFVNRAQLLKAIKKYPEIWDSNNKLHMCRSVTSPMWTEIAEQFGGHVPTVKLQSIWSQMKY 66
            |.||.|.  ..|:.::::.|.:::..:.||........:|..|:.:.|.....|:|:..|..|:.
 Worm    13 PLEDDFT--LALIDSVQRNPCVYNRYDPLHKVTDYKHEIWKLISIEIGYDGQPVELERKWKHMRD 75

  Fly    67 HY-------------------HNLVHRQ------ILH------KDRFNTKWEHF--EPMSFMYNI 98
            .|                   :|..|:.      :.|      ||..|:....|  :..:|:..:
 Worm    76 KYVRLRKQDKQKAPIKKTNKWYNYYHKMSFLDPYVEHRNRKRQKDYLNSNTPDFLDDDTAFLDGL 140

  Fly    99 TVAKIV--------------------GAQSSGGSGGGTSSDAPSTATE 126
            :|.:::                    .:.|||.:..|...|:|:...|
 Worm   141 SVKEMLKPESLLTSNDAGYNSPHTTSSSSSSGSNNNGRFLDSPTIDIE 188

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738 20/119 (17%)
MADF 226..316 CDD:214738
madf-4NP_505565.3 MADF 22..111 CDD:214738 14/89 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.