DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6163 and madf-5

Sequence 1:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_497028.1 Gene:madf-5 WormBaseID:WBGene00007242 Length:423 Species:Caenorhabditis elegans

Alignment Length:453 Identity:79/454 (17%)
Similarity:136/454 (30%) Gaps:154/454 (34%)


  Fly    11 AQLLKAIKKYPEIWDSNNKLHMCRSVTSPMWTEIAEQFGGHVPTVKLQSIWSQMKYHYHNLVHRQ 75
            |:|:..::|||.:::.:.:..........:|..||:....:......:..|.|::..|..  ..:
 Worm     9 ARLINEVRKYPCLYNHSRRGSGDTMERQRLWESIAKNIDPNCAAEFAKKRWLQLRDRYRK--ELK 71

  Fly    76 ILHKDRFNT--KWEHFEPMSFMYNITVAKIVGAQSSGGSGGGTSS-DAPSTATEAATVGEEPAAP 137
            |..|:.|.|  :|.:|..:|::.......|..|...|...|.:.| |.||               
 Worm    72 IAIKNGFVTPVRWCYFNQLSWLDPFLKDNIGQAADEGKKTGKSDSFDEPS--------------- 121

  Fly   138 VAPPPLPTATHGRGRPSGSFSWLQTATTPTAPQLPHLITQPPHSQGHGMTYTAFTGLVPPPA--- 199
                         |.|   |||.         ..|:|.:.....:...          ..||   
 Worm   122 -------------GTP---FSWF---------GFPNLNSIKDEMEDDD----------SDPALES 151

  Fly   200 TVASETVATPPRKLGRPS-SLHNSMRG-RIIDAIKTRPSLWAGRQRSEKGQGQSRTSAVWKEAAM 262
            :|....:|...::|...| .:.|...| :.:|          |......|.|.....        
 Worm   152 SVLDRLLAQTAQRLDSISPEIENDESGTQSLD----------GNLDGVDGDGDEEED-------- 198

  Fly   263 EMGLTPTLMQTRWSIIKQRYVDELQKERHAQYSHQSFRSTWEHFDRMSFMREILLKKVDEREQTR 327
                           :|.:..||::::...:...||        :.|:.::|.:..:..::.|..
 Worm   199 ---------------LKIKDEDEVEEDGPEKVKSQS--------EAMAMLKEAISAQSQQQTQQA 240

  Fly   328 EQIQEIVSEQQHHQQTQHHPS----------QHLHH-------------------------YRP- 356
            :|:|::       |||...||          :..||                         .|| 
 Worm   241 QQVQQV-------QQTPQKPSVESLIAANQARFAHHLAAQLTGMSSMLNGARKSEEAAIPPLRPS 298

  Fly   357 -PQPPAGLVEHAQDMPIGLVQHHHQEGHHPTLAMHHPQHSQPIRRRVKHESDLEWDPFEMILH 418
             |.|.|....|...........|.|:.....:..|..|..     ||.    |||...|.:|:
 Worm   299 TPPPTASTTSHFHPYKEAARNRHRQQTADNVMRYHLQQVG-----RVA----LEWLNDEDLLY 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738 17/88 (19%)
MADF 226..316 CDD:214738 11/90 (12%)
madf-5NP_497028.1 MADF 10..98 CDD:214738 17/90 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.