DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6163 and madf-2

Sequence 1:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_492896.1 Gene:madf-2 WormBaseID:WBGene00009461 Length:290 Species:Caenorhabditis elegans

Alignment Length:148 Identity:34/149 (23%)
Similarity:63/149 (42%) Gaps:17/149 (11%)


  Fly   227 IIDAIKTRPSLWAGRQRSEKGQGQSRTSAVWKEAAMEMG--------LTPTLMQTRWSIIKQRYV 283
            :|:||:.||.:|......|......:||.: :|...|:.        .|...::::|..:|..:|
 Worm    12 LINAIRNRPVIWDKNYFGESNYRTLKTSCL-REVTSELNSMFQMPIKFTCEDVRSQWKNLKDTFV 75

  Fly   284 DELQKERHAQYSHQSFRS-TWEHFDRMSFMREILLKKV-DEREQTREQIQEIVSEQQHHQ----- 341
            .:|:.....:|...:.:. ||:.:..::|:.|...|:: |..|.|.|......|..|..|     
 Worm    76 RKLRWVHEGKYMEDAMKEPTWKFYRMLTFLDEKEAKRLGDTCEHTYELAPNSTSCGQRAQISYEP 140

  Fly   342 -QTQHHPSQHLHHYRPPQ 358
             .|:....|..::..|||
 Worm   141 TSTEEKMFQMFNNQPPPQ 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 21/98 (21%)
madf-2NP_492896.1 MADF 11..107 CDD:214738 20/96 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47879
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.