DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6163 and LOC100330838

Sequence 1:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_002665853.1 Gene:LOC100330838 ID: Length:204 Species:Danio rerio

Alignment Length:205 Identity:45/206 (22%)
Similarity:82/206 (40%) Gaps:50/206 (24%)


  Fly   222 SMRGRIIDAIKTRPSLWAGRQRSEKGQGQSRTSAVWKEAAMEMGLTPTLMQTRWSIIKQRYVDEL 286
            :|..|:|.|:...|.|:.....|.|  ..:|.:..|:..::::.:.....:.||..::..::.:.
Zfish     4 TMEERLIAAVSDYPELYNSTINSYK--DAARKAKAWRAVSLQVEIPEEDCRRRWKSLRDMFIKDK 66

  Fly   287 ---QKERHAQYSHQSFRSTWEHFDRMSFMREILLKK---VDEREQTREQIQEIVSEQQHHQQTQH 345
               |:.|.:..||:|::.:|:    |||:...:..:   .||.|:.|:      .|.:..::|..
Zfish    67 RAEQRRRASGTSHRSWKYSWQ----MSFLTPFIQSRSLAADEPEEDRD------DEDKDEERTAD 121

  Fly   346 HPSQHLHHYRPPQPPAGLVEHAQDMPIGLVQHHHQEGHHPTL--AMHH-PQHSQPI-RRRVKH-- 404
            ..|..:               .||.          ||.|..|  |.|: ...||.. |:|..|  
Zfish   122 GNSAFV---------------VQDF----------EGDHGMLDGASHYSASGSQGSGRKRKWHME 161

  Fly   405 -ESDLEWDPF 413
             ..|||.:.|
Zfish   162 ANEDLEDEMF 171

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 20/93 (22%)
LOC100330838XP_002665853.1 MADF 8..96 CDD:214738 20/94 (21%)
BESS 167..200 CDD:281011 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.