DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6175 and CG11504

DIOPT Version :9

Sequence 1:NP_001261708.1 Gene:CG6175 / 39271 FlyBaseID:FBgn0036152 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster


Alignment Length:539 Identity:112/539 - (20%)
Similarity:176/539 - (32%) Gaps:174/539 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VEWSRSTILNFIEDYRRQRVLWDPNTKGYHIKQTKYEALKLLSQKYG--TEIRSIRSKIKSLRSS 116
            :||:|...|..|.:||.:|.|||.....|..|..|...|..:||..|  ..|..:..|..:||:.
  Fly     1 MEWTREKTLQLISEYRSRRGLWDMTCDEYRKKDVKQRLLNEVSQVLGGNIPINELEKKFHTLRTQ 65

  Fly   117 FHREHGKVLSGRNRGVIYQPMWFAYEAIRFI--------LDGERDQDRDQDQDQDAETETEVDEK 173
            :|||    :|...|...|...||.::.:.|:        ..|....|...|:.:....|...|  
  Fly    66 YHRE----ISRMKRKEPYNSKWFGFKNLVFLSSPYACRSTKGRLKADLQGDERKFVLGEVTAD-- 124

  Fly   174 LALMHSLDLEQLKADKLVDRDIILQVEQQQQQHDELTARIAATVAAVAAAAAAANARDRERDV-D 237
                |:.| ....|:...:.:..:..|..::.|                  |::.|::.|:.: :
  Fly   125 ----HNSD-SSTPANHNSNTNANMNEEYLRKNH------------------ASSRAQELEKLIEE 166

  Fly   238 TAGDMDTTRELELEEAAVGGGLIESSSAAVRLDWRVCIDFCTRSSSDLDGENYCNISAEDVKTEI 302
            |..|:|...|.||||                                  ||    :..:..|...
  Fly   167 TTKDVDDIDESELEE----------------------------------GE----VKPKQAKEMS 193

  Fly   303 IEHESELGMLDRRTSTPSPINYYKPTDLTYNHRKRKAMGVEHVVGALTLTPIKVVGGAVGAGTVG 367
            :...|              :|..:.|:...||.:             ||..:...|.||.|  |.
  Fly   194 VRFVS--------------LNEQEETEPLENHHQ-------------TLMDLHHQGNAVEA--VS 229

  Fly   368 SAGHQQQQQHQQQQMNHSQLAFQALQQHFSHNHGLSLSH--------------CNGQPQQQQQQH 418
            ...::..:.|.|.....|.              |.|..|              .:||.....::|
  Fly   230 FQANESGELHYQTTPTQST--------------GSSSVHVMPTRIIKIQRRDTSSGQEDSYFEEH 280

  Fly   419 -QHQPHHQQQQQQQALHLQHQQQQQHSSNMAQKRDRDRDLSTSNGNGNSSNTNNTSLEPIATSSN 482
             |..|...::...:|....|......|..:           .|:.||.:|:...||  |..|.||
  Fly   281 TQLHPPPVKRMYYEASPASHNTTSILSPAL-----------ESSANGTASSVLTTS--PGITMSN 332

  Fly   483 CSSSSSNNSAATPPKPLLGGGGLSANHV---------------DEYGVFGEYVAITIRKLKTSKS 532
            ......|    |||||      ..|..:               ||:..:|||||..:|.:...:.
  Fly   333 LRLPKVN----TPPKP------AQAQAIPSPPPPTIVSLPPARDEFATYGEYVANEMRAISNREV 387

  Fly   533 KIVVKHLINNLLYEAELGK 551
            .:.:||.||..::||.:.:
  Fly   388 LVALKHRINTAIFEASMAE 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6175NP_001261708.1 MADF_DNA_bdg 64..147 CDD:287510 26/84 (31%)
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 26/84 (31%)
CytochromB561_N 238..>409 CDD:286826 45/206 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D0D8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.