DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyro and CG8281

DIOPT Version :10

Sequence 1:NP_001261708.1 Gene:Dyro / 39271 FlyBaseID:FBgn0036152 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_648161.1 Gene:CG8281 / 38880 FlyBaseID:FBgn0035824 Length:348 Species:Drosophila melanogaster


Alignment Length:103 Identity:27/103 - (26%)
Similarity:54/103 - (52%) Gaps:5/103 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EWSRSTILNFIEDYRRQRVLWDPNTKGYHIKQTKYEA-LKLLS----QKYGTEIRSIRSKIKSLR 114
            |.:|..:..||:.||...||||.:.:.|..::.:.|| |:|:.    .|....:..::.||.:||
  Fly    17 EENRHYLRAFIQTYRDLPVLWDTSLRDYTNREKRAEAYLRLVPIYHYLKRDATVEDVKKKINTLR 81

  Fly   115 SSFHREHGKVLSGRNRGVIYQPMWFAYEAIRFILDGER 152
            :::.:|...|.|....|.::.|..:.::.:.|:.:.|:
  Fly    82 TNYRKELKVVESALRSGSLHSPRCWTFQELDFLRNSEK 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DyroNP_001261708.1 MADF_DNA_bdg 64..147 CDD:463144 23/87 (26%)
CG8281NP_648161.1 MADF_DNA_bdg 26..114 CDD:463144 23/87 (26%)

Return to query results.
Submit another query.