powered by:
                  
 
    
 
    
             
          
            Protein Alignment CG6175 and CG8281
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001261708.1 | 
            Gene: | CG6175 / 39271 | 
            FlyBaseID: | FBgn0036152 | 
            Length: | 569 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_648161.1 | 
            Gene: | CG8281 / 38880 | 
            FlyBaseID: | FBgn0035824 | 
            Length: | 348 | 
            Species: | Drosophila melanogaster | 
          
        
        
        
          
            | Alignment Length: | 103 | 
            Identity: | 27/103 - (26%) | 
          
          
            | Similarity: | 54/103 -  (52%) | 
            Gaps: | 5/103 - (4%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly    55 EWSRSTILNFIEDYRRQRVLWDPNTKGYHIKQTKYEA-LKLLS----QKYGTEIRSIRSKIKSLR 114 
            |.:|..:..||:.||...||||.:.:.|..::.:.|| |:|:.    .|....:..::.||.:|| 
  Fly    17 EENRHYLRAFIQTYRDLPVLWDTSLRDYTNREKRAEAYLRLVPIYHYLKRDATVEDVKKKINTLR 81 
 
  Fly   115 SSFHREHGKVLSGRNRGVIYQPMWFAYEAIRFILDGER 152 
            :::.:|...|.|....|.::.|..:.::.:.|:.:.|: 
  Fly    82 TNYRKELKVVESALRSGSLHSPRCWTFQELDFLRNSEK 119 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Isobase | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoFinder | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            1 | 
            1.100 | 
            - | 
            - | 
            P | 
            PTHR21505 | 
          
          
            | Phylome | 
            1 | 
            0.910 | 
            - | 
            - | 
             | 
             | 
          
          
            | RoundUp | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            2 | 2.010 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.