DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6175 and CG3386

Sequence 1:NP_001261708.1 Gene:CG6175 FlyBaseID:FBgn0036152 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_001261216.1 Gene:CG3386 FlyBaseID:FBgn0035152 Length:288 Species:Drosophila melanogaster

Alignment Length:128 Identity:35/129 (27%)
Similarity:60/129 (47%) Gaps:19/129 (15%)


  Fly    64 FIEDYRRQRVLWDPNTKGYHIKQTKYEALKLLSQKYGTEIR------SIRSKIKSLRSSFHREHG 122
            |:..|:....|||.:...|..|:.:..|.:||.:|. .||:      .:..:|...|:::.||..
  Fly    20 FLALYQGMPELWDVHHLNYRNKELRNRAYELLERKL-REIQPNATRTEVGRRINIFRTNYRREQM 83

  Fly   123 KVLSGRNRGV---IYQP-MWFAYEAIRFILDGERDQDRDQD-----QDQDAETETEVDEKLAL 176
            ::|..:..|:   :.:| :|| |:.:.|:|..|..|.|.:.     |.||...|.  |:|..|
  Fly    84 RILKQKELGLHSDLCKPTLWF-YDYMGFLLTQETFQHRTRKGRGGRQKQDFRREK--DDKYPL 143

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6175NP_001261708.1 MADF_DNA_bdg 64..147 CDD:287510 24/93 (26%)
CG3386NP_001261216.1 MADF_DNA_bdg 20..111 CDD:287510 24/93 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21505
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.