DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6175 and CG3163

DIOPT Version :9

Sequence 1:NP_001261708.1 Gene:CG6175 / 39271 FlyBaseID:FBgn0036152 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_611872.1 Gene:CG3163 / 37836 FlyBaseID:FBgn0034961 Length:368 Species:Drosophila melanogaster


Alignment Length:207 Identity:44/207 - (21%)
Similarity:92/207 - (44%) Gaps:31/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 NFIEDYRRQRVLWDPNTKGYHIKQTKYEA-LKLL--SQKYGT--EIRSIRSKIKSLRSSFHREHG 122
            :|||:|:....||..::..:..:..:.|| .||:  :.|:|.  .:...:.||.:||.:|..:..
  Fly     6 DFIEEYKSNPCLWKADSADFRNRSRRQEAYAKLIEVATKHGEMYNVERTKQKINNLRCAFRHQLR 70

  Fly   123 KVLSGRNRGVIYQP-----MWFAYEAIRFILDGERDQDRDQDQDQDAETETEVDEKLALMHSLDL 182
            |....:.:|..|:|     .:|  |::.|:          :|::..|:.:.:.::.:.|.:|:.|
  Fly    71 KYNEVKKKGEKYEPYCPKRRYF--ESLMFL----------KDEEIPADKKFKREQSVCLDNSMQL 123

  Fly   183 -EQLKADKLVDRDIILQ-----VEQQQQQHDELTARIAATVAAVAAAAAAANARDRERDVDTAGD 241
             .....|:..|.:.:.:     .:..:...:.......|.:...|||||||:.....:.|:.|..
  Fly   124 GAPENGDEYSDAESLHKPPKPTADSIKMSPNNSANEFCANIFEEAAAAAAADPVISIKTVNNANS 188

  Fly   242 M---DTTRELEL 250
            .   .|.:|:|:
  Fly   189 HASGATIKEVEI 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6175NP_001261708.1 MADF_DNA_bdg 64..147 CDD:287510 23/92 (25%)
CG3163NP_611872.1 MADF_DNA_bdg 7..98 CDD:287510 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.