| Sequence 1: | NP_001261708.1 | Gene: | CG6175 / 39271 | FlyBaseID: | FBgn0036152 | Length: | 569 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001286483.1 | Gene: | CG33017 / 36811 | FlyBaseID: | FBgn0053017 | Length: | 1630 | Species: | Drosophila melanogaster | 
| Alignment Length: | 531 | Identity: | 81/531 - (15%) | 
|---|---|---|---|
| Similarity: | 165/531 - (31%) | Gaps: | 167/531 - (31%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    68 YRRQRVLWDPNTKGYHIKQTKYEALKLLSQKY--GTEIRSIRSKIKSLRSSFHREHGKVLSGRNR 130 
  Fly   131 GVIYQPMWFAYEAIRFI--LDGERDQDRDQDQDQDAETETEVDEKLALMHSLDLEQLKADKLVDR 193 
  Fly   194 DIILQVEQQQQQ-----HDELTARIAATVAAVAAAAAAANARDRERDVDTAGDMDTTRELELEEA 253 
  Fly   254 AVGGGLIESSSAAVRLDWRVCIDFCTRSSSDLDGE--NYCNISAEDVKTEIIEHESELGMLDRRT 316 
  Fly   317 STPSPINYYKPTDLTYNHRKRKAMGVEHVVGALTLTPIKVVGGAVGAGTVGSAGHQQQQQHQQQQ 381 
  Fly   382 MNHSQLAFQALQQHFSHNHGLSLSHCNGQPQQQQQQHQHQPHHQQ---QQQQQAL---------- 433 
  Fly   434 -------HLQHQQQQQHSSN----------------------------MAQKRDRDRDLSTSNGN 463 
  Fly   464 GNSSNTNNTSLEPIATSS---------NCSSSSSNN------------------SAATPPKPLLG 501 
  Fly   502 GGGLSANHVDE 512 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG6175 | NP_001261708.1 | MADF_DNA_bdg | 64..147 | CDD:287510 | 17/80 (21%) | 
| CG33017 | NP_001286483.1 | MADF_DNA_bdg | 21..106 | CDD:287510 | 17/80 (21%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR21505 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||