DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6175 and CG33017

Sequence 1:NP_001261708.1 Gene:CG6175 FlyBaseID:FBgn0036152 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_001286483.1 Gene:CG33017 FlyBaseID:FBgn0053017 Length:1630 Species:Drosophila melanogaster

Alignment Length:531 Identity:81/532 (15%)
Similarity:165/532 (31%) Gaps:167/532 (31%)


  Fly    68 YRRQRVLWDPNTKGYHIKQTKYEALKLLSQKY--GTEIRSIRSKIKSLRSSFHREHGKVLSGRNR 130
            ||....||:|.:.|:|....|.:|.:.::::.  |.....:..::..||..:.:|...:.:.:..
  Fly    25 YRSNECLWNPKSPGFHSGSAKDDAWRQITRRMNCGLTPDQVELQVLGLRHYYSKELAAIRNSQIE 89

  Fly   131 GVIYQPMWFAYEAIRFI--LDGERDQDRDQDQDQDAETETEVDEKLALMHSLDLEQLKADKLVDR 193
            |..|.|.:..:|.:.|:  |:.|.:....:.......:|......||.: |....:.:......:
  Fly    90 GYSYSPRYSYFEDLHFLGNLEEEANCPIKEGHFPPNFSEDTFISPLAFL-SPSCSETRCGYTFYK 153

  Fly   194 DIILQVEQQQQQ-----HDELTARIAATVAAVAAAAAAANARDRERDVDTAGDMDTTRELELEEA 253
             :||:.|...::     |:..|:                   ..:|...||              
  Fly   154 -MILEPEPPNEEFLGVHHERSTS-------------------GNDRWYPTA-------------- 184

  Fly   254 AVGGGLIESSSAAVRLDWRVCIDFCTRSSSDLDGE--NYCNISAEDVKTEIIEHESELGMLDRRT 316
                                   :|.|...:.|.:  ..|.:..:..:.: ...:|.|...:..:
  Fly   185 -----------------------YCVRCKPEEDEDPCEACELRGQSSRPQ-FGSKSSLEGGESGS 225

  Fly   317 STPSPINYYKPTDLTYNHRKRKAMGVEHVVGALTLTPIKVVGGAVGAGTVGSAGHQQQQQHQQQQ 381
            :.|...|.|:..|  .:::.:|:...::..|.....|.|               ...:::..|.|
  Fly   226 TNPRMSNRYQEQD--QSNKFQKSDSKQYRTGKPCSCPTK---------------DNPEKRSSQTQ 273

  Fly   382 MNHSQLAFQALQQHFSHNHGLSLSHCNGQPQQQQQQHQHQPHHQQ---QQQQQAL---------- 433
            .|...:.......:.|..:|:......|.....|::.:.:|..::   :..|::.          
  Fly   274 QNDVYVGADNWDGYESVGNGIRSDRWPGPRLCSQKRGEWKPRFRKVIGEDNQKSCCDSWKRNNNA 338

  Fly   434 -------HLQHQQQQQHSSN----------------------------MAQKRDRDRDLSTSNGN 463
                   .|..||.|..|.:                            :.||:.|||.||.:..|
  Fly   339 VCGRLLDQLAKQQNQPGSYSDDGDSVRNQSCGCTKNRRQSGEDQLNVMLLQKKYRDRTLSNNANN 403

  Fly   464 GNSSNTNNTSLEPIATSS---------NCSSSSSNN------------------SAATPPKPLLG 501
            ..:...:||  :||:..:         ||...:.|.                  :...||   ..
  Fly   404 PTTDRHSNT--QPISDQTYYNTSHPVPNCCYCTYNQVNQDVQRCNIHGCQCIYCNQTVPP---AH 463

  Fly   502 GGGLSANHVDE 512
            |.....:|||:
  Fly   464 GNYYQPHHVDQ 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6175NP_001261708.1 MADF_DNA_bdg 64..147 CDD:287510 18/81 (22%)
CG33017NP_001286483.1 MADF_DNA_bdg 21..106 CDD:287510 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21505
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.