DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6175 and CG5953

Sequence 1:NP_001261708.1 Gene:CG6175 FlyBaseID:FBgn0036152 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_001260503.1 Gene:CG5953 FlyBaseID:FBgn0032587 Length:701 Species:Drosophila melanogaster

Alignment Length:684 Identity:130/685 (19%)
Similarity:209/685 (31%) Gaps:198/685 (29%)


  Fly    28 LPLPL-SPTATTTTAASGATATAPADRVEWSRSTILNFIEDYRRQRVLWDPNTKGYHIKQTKYEA 91
            :|||: ....:.....||...|:| ..:||:....|..||.||....||:.....|..|..::.|
  Fly    50 IPLPVGGGGGSLPVGGSGGGDTSP-KIMEWTNDDALELIEQYRCHTELWNRADPKYKDKLCRFRA 113

  Fly    92 LKLLSQKYGTEIRSIRSKIKSLRSSFHREHGKVLSGRNRGVIYQP-MWFAYEAIRFILDGERDQD 155
            ...:::::|.....:..|:..|.:.:.||..|:.....:|:...| .|:|::...|:..|.....
  Fly   114 WSEIAERFGCSKAEVERKMNVLLTQYRREKHKMFVKIYQGIQPNPSKWYAFKRFDFMEAGGGSLS 178

  Fly   156 RDQDQDQDAETETEVDEKLALMHSLDLEQLKADKLVDRDIILQVEQQQQQHDELTARIAATVAAV 220
            ...........                   .:..||...:  ........|:.|....||..|..
  Fly   179 GGGSVGSGVNA-------------------ASGNLVPNPV--SSSAAAAAHNGLNGLAAAAAAYE 222

  Fly   221 AAAAAAANARDRERDVDTAGDMDTT-----RELELEEAAVGGG-------LIESSSAAVRLD-WR 272
            :...|||........|...|...:.     |.::.:|....|.       ||.||..   || |.
  Fly   223 SGTIAAAGNGGAPPTVPGGGAPGSQTVMQHRRIKTKELKYFGAMGLNIPMLIASSQT---LDSWN 284

  Fly   273 VCIDFCTRSSSDLDGENYCNISAEDVKTEIIEHESELGMLDRRTSTPSPINYY------------ 325
            ....:....|....|.:....||           ...|:..::...|.|::|:            
  Fly   285 TAGQYSPPISGSGGGGSERGGSA-----------GGGGVPPQQLRVPLPMSYHGGAGGGSSSSDF 338

  Fly   326 -----KPTDLTYNHRKRKAMGVEHVVGALTLTPI--KV-VGGAVGAGTVGSAGHQQQQQHQ--QQ 380
                 |..|.:.|.......  |.|..|..|..:  || :....|||..|..|...::.:.  ..
  Fly   339 QQSPLKTMDTSDNEDNNNTK--EDVAAAAALGQLAAKVELRSPAGAGPGGGGGSSSREANDPTSD 401

  Fly   381 QMNHSQLAFQA-------LQQHFSHNHGLSLSHCNGQ---PQQQQQQHQHQPH--HQQQQQQQAL 433
            .:...:...:|       ...|.:|.:.|..|...|:   |:|..:|..|.||  |..|||||.|
  Fly   402 PIKPDRTLSEAGSSPIPNTNMHEAHKNHLLNSPAGGRSVTPRQAHEQLHHHPHTQHHLQQQQQQL 466

  Fly   434 HLQHQQQQQHSSNMAQKR----------DRDRDL-------STSNGNGNSSNTNNTSLEPIATSS 481
            ..||||.||......|::          |..::|       :...|.|........:..|...|.
  Fly   467 QQQHQQLQQQQLQQHQQQQQLHHGHEELDIKQELVDYFHGQAAGGGGGGGGGVVGPAPPPPPESH 531

  Fly   482 NCSSSSSNNS-------------------------------AATPPKPL----LGGGGLSANHV- 510
            ...||:...|                               |:||..||    |.|.| ||.|: 
  Fly   532 RSYSSAGEESRLQLVDMAQDLRVAQAKANFGAFILPPRGSDASTPAMPLNMRKLTGAG-SAGHML 595

  Fly   511 --------------------------------------------------------DEYGVFGEY 519
                                                                    |:....|..
  Fly   596 MNSLLGSRESMSDGEEPDPDNDEATESAASPGHIKSSVSAQAAVAASAFYAESLNRDDCDFIGSN 660

  Fly   520 VAITIRKLKTSKSKIVVKHLINNLLYEAELGKYD 553
            |::.:|.:..:: :|:.:.||:.:||..:..:.:
  Fly   661 VSLKLRTMDRTQ-RIIAEKLISEVLYYGQFNELE 693

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6175NP_001261708.1 MADF_DNA_bdg 64..147 CDD:287510 20/84 (24%)
CG5953NP_001260503.1 MADF_DNA_bdg 86..170 CDD:287510 20/84 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21505
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.