DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6175 and CG15601

Sequence 1:NP_001261708.1 Gene:CG6175 FlyBaseID:FBgn0036152 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_573058.1 Gene:CG15601 FlyBaseID:FBgn0030673 Length:277 Species:Drosophila melanogaster

Alignment Length:504 Identity:87/505 (17%)
Similarity:135/505 (27%) Gaps:263/505 (52%)


  Fly    61 ILNFIEDYRRQRVLWDPNTKGYHIKQTKYEALKLLSQKYGTEIRS----------IRSKIKSLRS 115
            |..|:|.||||..|::.....|..:.::.||       ||..|||          |:.||||:|:
  Fly    11 ITEFLEAYRRQPCLYNTLLDSYKNRVSREEA-------YGAIIRSLKIPQLTVSDIKLKIKSVRT 68

  Fly   116 SFHREHGKVLSGRNRGVIYQP--MWFAYEAIRFILDGERDQDRDQDQDQDAETETEVDEKLALMH 178
            .:.:|....:..:..|..|:|  .||.. |..|:........:.|.::..:              
  Fly    69 VYSKELRIWMREKELGRTYEPKLFWFRL-ADSFLRSVSLSHCKRQGKNNSS-------------- 118

  Fly   179 SLDLEQLKADKLVDRDIILQVEQQQQQHDELTARIAATVAAVAAAAAAANARDRERDVDTAGDMD 243
            |..|..:|:|:                    |:::..|.||               |:..:.|  
  Fly   119 SAQLTTIKSDE--------------------TSKLLCTAAA---------------DITMSED-- 146

  Fly   244 TTRELELEEAAVGGGLIESSSAAVRLDWRVCIDFCTRSSSDLDGENYCNISAEDVKTEIIEHESE 308
               .||.|:|.|.|...|                             |.:........|.:.:|.
  Fly   147 ---ALEEEDAEVNGEPEE-----------------------------CPLEESRPTASICKDDST 179

  Fly   309 LGMLDRRTSTPSPINYYKPTDLTYNHRKRKAMGVEHVVGALTLTPIKVVGGAVGAGTVGSAGHQQ 373
            |.:.|                                                          |.
  Fly   180 LCLAD----------------------------------------------------------QP 186

  Fly   374 QQQHQQQQMNHSQLAFQALQQHFSHNHGLSLSHCNGQPQQQQQQHQHQPHHQQQQQQQALHLQHQ 438
            ||:|..|                    |.|.|             |..||               
  Fly   187 QQEHYSQ--------------------GCSSS-------------QQLPH--------------- 203

  Fly   439 QQQQHSSNMAQKRDRDRDLSTSNGNGNSSNTNNTSLEPIATSSNCSSSSSNNSAATPPKPLLGGG 503
                   .|||::.:                ..|||:                            
  Fly   204 -------TMAQRKSK----------------YITSLD---------------------------- 217

  Fly   504 GLSANHVDEYGVFGEYVAITIRKLKTSKSKIVVKHLINNLLYEAELGKY 552
              ||.. |:..:||:.:|..:|.:..|.|:.|.|..|..:|:|||.|::
  Fly   218 --SAGE-DDLIIFGQSIASQLRTIPDSYSRSVAKLRIQQVLFEAETGQF 263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6175NP_001261708.1 MADF_DNA_bdg 64..147 CDD:287510 29/95 (31%)
CG15601NP_573058.1 MADF_DNA_bdg 14..101 CDD:287510 29/95 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2D0D8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21505
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.