DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6175 and CG30403

Sequence 1:NP_001261708.1 Gene:CG6175 FlyBaseID:FBgn0036152 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_726108.3 Gene:CG30403 FlyBaseID:FBgn0050403 Length:302 Species:Drosophila melanogaster

Alignment Length:98 Identity:26/99 (26%)
Similarity:48/99 (48%) Gaps:22/99 (22%)


  Fly    56 WSRSTILNFIEDYRRQRVLWDPNTKGYHIKQTKYEALKLLSQ---------KYGTEIRSIRSKIK 111
            :|....:.|:|.|.|:..||:   |..::::.:..|.:.:..         :.|..|:.::.|||
  Fly    16 FSDERTVKFVELYGREPCLWN---KRPYLRRARSAAYRRIQSGINADIEPYESGLTIQGVKMKIK 77

  Fly   112 SLRSSFHREHGKV--LSGRNRGVIYQPM--WFA 140
            :||:.:|:|..|:  :.|      |||.  |||
  Fly    78 NLRTGYHQELKKIRTIPG------YQPKTPWFA 104

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6175NP_001261708.1 MADF_DNA_bdg 64..147 CDD:287510 25/91 (27%)
CG30403NP_726108.3 GT1 24..103 CDD:304916 23/88 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2D0D8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21505
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.