DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7607 and ptprfb

Sequence 1:NP_648449.1 Gene:CG7607 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_009296732.1 Gene:ptprfb ZFINID:ZDB-GENE-060503-530 Length:1927 Species:Danio rerio

Alignment Length:127 Identity:30/128 (23%)
Similarity:56/128 (44%) Gaps:12/128 (9%)


  Fly    23 DLIYIAAQRSTAGKTERRNYTGKKPVVIQHRSQDAVNYYDHENGAKIIKSSHFELDYTLGRKITF 87
            :.||.....::.|:.   |.:.|..|:.:::........|.....|:::.:         |..|.
Zfish   104 EAIYECTATNSLGEI---NTSAKLTVLEENQIPHGFPTIDMGPQLKVVERT---------RTTTM 156

  Fly    88 FCMAQGNPRPTITWFKDGAELYQHRFFQVHESHIEANIVKSKMEIDPTTQMDAGFYECQADN 149
            .|.|.|||.|.||||||...:..:...::.:.....:.::..::|:.:.:.|.|.|||.|.|
Zfish   157 LCAASGNPDPEITWFKDFLPVDINGNGRIKQLRSGGSPIRGALQIENSEESDQGKYECVATN 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7607NP_648449.1 Ig 85..159 CDD:143165 21/66 (32%)
ptprfbXP_009296732.1 I-set 35..126 CDD:254352 5/25 (20%)
Ig2_RPTP_IIa_LAR_like 155..233 CDD:319301 21/65 (32%)
Ig3_RPTP_IIa_LAR_like 261..329 CDD:143216
FN3 334..423 CDD:238020
FN3 430..522 CDD:238020
FN3 527..615 CDD:238020
FN3 623..717 CDD:238020
fn3 725..823 CDD:306538
FN3 835..916 CDD:238020
FN3 933..1021 CDD:238020
PTPc 1397..1626 CDD:238006
PTPc 1687..1917 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000235
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.