DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7607 and PTPRS

Sequence 1:NP_648449.1 Gene:CG7607 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_002841.3 Gene:PTPRS HGNCID:9681 Length:1948 Species:Homo sapiens

Alignment Length:71 Identity:25/72 (35%)
Similarity:34/72 (47%) Gaps:4/72 (6%)


  Fly    83 RKITFFCMAQGNPRPTITWFKD----GAELYQHRFFQVHESHIEANIVKSKMEIDPTTQMDAGFY 143
            |..|..|.|.|||.|.||||||    .......|..|:.....|:..::..::|:.:.:.|.|.|
Human   150 RTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSETFESTPIRGALQIESSEETDQGKY 214

  Fly   144 ECQADN 149
            ||.|.|
Human   215 ECVATN 220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7607NP_648449.1 Ig 85..159 CDD:143165 24/70 (34%)
PTPRSNP_002841.3 Ig 32..120 CDD:299845
I-set 33..124 CDD:254352
Important for binding to glycosaminoglycan chains. {ECO:0000250|UniProtKB:B0V2N1} 68..72
IG_like 141..234 CDD:214653 25/72 (35%)
Ig2_RPTP_IIa_LAR_like 152..235 CDD:143215 24/70 (34%)
IG_like 251..328 CDD:214653
Ig3_RPTP_IIa_LAR_like 259..327 CDD:143216
FN3 332..421 CDD:238020
FN3 428..520 CDD:238020
FN3 525..613 CDD:238020
FN3 621..715 CDD:238020
FN3 723..828 CDD:238020
FN3 838..920 CDD:238020
FN3 932..1029 CDD:238020
FN3 1037..>1097 CDD:238020
PTPc 1392..1647 CDD:214550
PTPc 1418..1647 CDD:238006
Substrate binding. {ECO:0000250} 1589..1595
PTPc 1679..1938 CDD:214550
PTPc 1708..1938 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000235
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.