DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7607 and PTPRF

Sequence 1:NP_648449.1 Gene:CG7607 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_005271136.1 Gene:PTPRF HGNCID:9670 Length:1922 Species:Homo sapiens

Alignment Length:151 Identity:36/152 (24%)
Similarity:59/152 (39%) Gaps:34/152 (22%)


  Fly    23 DLIYIAAQRSTAGKTERRNYTGKKPVVIQHRSQDAVNYYDHENGAKIIKSSHFELDYTLGRKITF 87
            :.||.....::.|:.   |.:.|..|:.:.:........|.....|:::.:         |..|.
Human   102 EAIYECTATNSLGEI---NTSAKLSVLEEEQLPPGFPSIDMGPQLKVVEKA---------RTATM 154

  Fly    88 FCMAQGNPRPTITWFKDGAELYQHRFFQVHESHIEANIVKSK---MEIDPTTQMDAGFYECQAD- 148
            .|.|.|||.|.|:||||        |..|..:.....|.:.:   ::|:.:.:.|.|.|||.|. 
Human   155 LCAAGGNPDPEISWFKD--------FLPVDPATSNGRIKQLRSGALQIESSEESDQGKYECVATN 211

  Fly   149 ----------NIYAIDRRGFR 159
                      |:|..|:|..|
Human   212 SAGTRYSAPANLYVRDQREVR 232

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7607NP_648449.1 Ig 85..159 CDD:143165 26/88 (30%)
PTPRFXP_005271136.1 I-set 33..124 CDD:254352 5/25 (20%)
Ig 50..121 CDD:143165 4/22 (18%)
I-set 135..225 CDD:254352 27/107 (25%)
Ig2_RPTP_IIa_LAR_like 152..226 CDD:143215 24/82 (29%)
IG_like 242..319 CDD:214653
Ig3_RPTP_IIa_LAR_like 250..318 CDD:143216
FN3 323..412 CDD:238020
FN3 419..511 CDD:238020
FN3 516..605 CDD:238020
fn3 613..700 CDD:278470
FN3 714..820 CDD:238020
FN3 825..914 CDD:238020
FN3 923..1011 CDD:238020
FN3 1020..>1079 CDD:238020
PTPc 1366..1621 CDD:214550
PTPc 1392..1621 CDD:238006
PTPc 1657..1912 CDD:214550
PTPc 1682..1912 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000235
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.