Protein Alignment CG7607 and PTPRD

DIOPT Version :9

• Sequence 1: NP_648449.1
• Gene: CG7607 / 39263
• FlyBaseID: FBgn0036145
• Length: 167
• Species: Drosophila melanogaster
• Sequence 2: NP_001364887.1
• Gene: PTPRD / 5789
• HGNCID: 9668
• Length: 1932
• Species: Homo sapiens
• Alignment Length: 71
• Identity: 25/71 - (35%)
• Similarity: 33/71 - (46%)
• Gaps: 4/71 - (5%)

  Fly    83 RKITFFCMAQGNPRPTITWFKD----GAELYQHRFFQVHESHIEANIVKSKMEIDPTTQMDAGFY 143
            |..|..|.|.|||.|.||||||    .......|..|:....|....::..::|:.:.:.|.|.|
Human   141 RTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKY 205

  Fly   144 ECQADN 149
            ||.|.|
Human   206 ECVATN 211

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
CG7607	NP_648449.1	Ig_3	70..149	CDD:404760	24/69 (35%)
		Ig strand B	85..89	CDD:409353	1/3 (33%)
		Ig strand C	98..102	CDD:409353	2/3 (67%)
		Ig strand E	123..132	CDD:409353	0/8 (0%)
		Ig strand F	142..147	CDD:409353	3/4 (75%)
PTPRD	NP_001364887.1	I-set	24..115	CDD:400151
		Ig strand A'	32..36	CDD:409353
		Ig strand B	39..48	CDD:409353
		Ig strand C	54..59	CDD:409353
		Ig strand C'	62..65	CDD:409353
		Ig strand D	68..75	CDD:409353
		Ig strand E	76..86	CDD:409353
		Ig strand F	94..102	CDD:409353
		Ig strand G	105..115	CDD:409353
		IgI_2_RPTP_IIa_LAR_like	127..226	CDD:409400	25/71 (35%)
		Ig strand B	143..147	CDD:409400	1/3 (33%)
		Ig strand C	156..160	CDD:409400	2/3 (67%)
		Interaction with IL1RAPL1. /evidence=ECO:0000250	180..189		1/8 (13%)
		Mini-exon peptide A9, sufficient for interaction with IL1RAPL1. /evidence=ECO:0000250|UniProtKB:Q64487	181..189		1/7 (14%)
		Ig strand E	190..194	CDD:409400	0/3 (0%)
		Ig strand F	204..209	CDD:409400	3/4 (75%)
		Ig strand G	216..219	CDD:409400
		Mini-exon peptide B, required for interaction with SLITRK2 and in the function in pre-synaptic differentiation, Acts as an adjustable linker to control relative positions and orientations of the PTPRD second and third immunoglobilin domains for their simultaneous interactions with the first immunoglobilin domain of IL1RAPL1 and IL1RAP, Modulates affinity for IL1RAPL1 and IL1RAP. /evidence=ECO:0000250|UniProtKB:Q64487	227..230
		IgI_3_RPTP_IIa_LAR_like	239..320	CDD:409401
		Ig strand B	253..257	CDD:409401
		Ig strand C	266..270	CDD:409401
		Ig strand E	287..291	CDD:409401
		Ig strand F	299..304	CDD:409401
		Ig strand G	312..315	CDD:409401
		FN3	323..412	CDD:238020
		FN3	419..511	CDD:238020
		FN3	516..604	CDD:238020
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	603..623
		FN3	612..706	CDD:238020
		FN3	713..819	CDD:238020
		FN3	824..919	CDD:238020
		FN3	922..1013	CDD:238020
		FN3	1023..>1084	CDD:238020
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	1304..1324
		R-PTPc-D-1	1354..1637	CDD:350472
		Substrate binding. /evidence=ECO:0000250	1573..1579
		R-PTP-D-2	1638..1929	CDD:350476

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910