DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7607 and PTPRD

Sequence 1:NP_648449.1 Gene:CG7607 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_016870447.1 Gene:PTPRD HGNCID:9668 Length:1932 Species:Homo sapiens

Alignment Length:71 Identity:25/72 (35%)
Similarity:33/72 (46%) Gaps:4/72 (6%)


  Fly    83 RKITFFCMAQGNPRPTITWFKD----GAELYQHRFFQVHESHIEANIVKSKMEIDPTTQMDAGFY 143
            |..|..|.|.|||.|.||||||    .......|..|:....|....::..::|:.:.:.|.|.|
Human   141 RTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKY 205

  Fly   144 ECQADN 149
            ||.|.|
Human   206 ECVATN 211

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7607NP_648449.1 Ig 85..159 CDD:143165 24/70 (34%)
PTPRDXP_016870447.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000235
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.