DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7607 and Lar

Sequence 1:NP_648449.1 Gene:CG7607 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001260594.1 Gene:Lar FlyBaseID:FBgn0000464 Length:2032 Species:Drosophila melanogaster

Alignment Length:129 Identity:31/130 (24%)
Similarity:49/130 (38%) Gaps:34/130 (26%)


  Fly    42 YTGKK-----PVVIQHRSQDAVNYYDHENGAKIIKSSHFELDYTLGRKITFFCMAQGNPRPTITW 101
            |.|.|     ||:.|            ..|.::|:         :|..:...|.|.|||.|.|.|
  Fly   130 YEGDKTPAGFPVITQ------------GPGTRVIE---------VGHTVLMTCKAIGNPTPNIYW 173

  Fly   102 FKDGAELYQHRFFQVHESHIEANIVKSKMEIDPTTQMDAGFYECQADNIYAIDRRGFRTDYVMV 165
            .|:..        :|..|:...::....::|:.:.:.|.|.|||.|:|....:.......||.|
  Fly   174 IKNQT--------KVDMSNPRYSLKDGFLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKV 229

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7607NP_648449.1 Ig 85..159 CDD:143165 19/74 (26%)
LarNP_001260594.1 Ig 35..129 CDD:299845
I-set 36..129 CDD:254352
IG_like 146..227 CDD:214653 23/98 (23%)
Ig 159..228 CDD:299845 21/77 (27%)
I-set 234..318 CDD:254352
Ig3_RPTP_IIa_LAR_like 249..317 CDD:143216
fn3 324..404 CDD:278470
FN3 423..514 CDD:238020
FN3 520..610 CDD:238020
FN3 616..707 CDD:238020
FN3 712..810 CDD:238020
FN3 832..907 CDD:238020
FN3 914..1005 CDD:238020
FN3 1012..1101 CDD:238020
fn3 1106..1198 CDD:278470
PTPc 1476..1731 CDD:214550
PTPc 1503..1731 CDD:238006
PTPc 1763..2022 CDD:214550
PTPc 1791..2022 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000235
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.