DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7607 and pyp3

Sequence 1:NP_648449.1 Gene:CG7607 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_594934.1 Gene:pyp3 PomBaseID:SPAC11E3.09 Length:303 Species:Schizosaccharomyces pombe

Alignment Length:31 Identity:6/32 (19%)
Similarity:15/32 (47%) Gaps:0/32 (0%)


  Fly   128 SKMEIDPTTQMDAGFYECQADNIYAIDRRGF 158
            ||.|:|....:.:.....:..::.::|:..|
pombe   254 SKFEVDNIANIVSSLRSQRMQSVQSVDQLVF 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7607NP_648449.1 Ig 85..159 CDD:143165 6/32 (19%)
pyp3NP_594934.1 COG5599 1..303 CDD:227886 6/32 (19%)
AbiGii_2 <18..69 CDD:293478
PTPc 52..291 CDD:238006 6/32 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000235
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.