DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7607 and Ptprs

Sequence 1:NP_648449.1 Gene:CG7607 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_006523937.1 Gene:Ptprs MGIID:97815 Length:1920 Species:Mus musculus

Alignment Length:70 Identity:26/71 (37%)
Similarity:33/71 (46%) Gaps:11/71 (15%)


  Fly    83 RKITFFCMAQGNPRPTITWFKDGAELYQHRFFQVHESHIEANIVKSK---MEIDPTTQMDAGFYE 144
            |..|..|.|.|||.|.||||||        |..|..|.....|.:.:   ::|:.:.:.|.|.||
Mouse   150 RTATMLCAASGNPDPEITWFKD--------FLPVDPSASNGRIKQLRSGALQIESSEETDQGKYE 206

  Fly   145 CQADN 149
            |.|.|
Mouse   207 CVATN 211

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7607NP_648449.1 Ig 85..159 CDD:143165 25/69 (36%)
PtprsXP_006523937.1 Ig 32..120 CDD:299845
I-set 33..124 CDD:254352
IG_like 141..225 CDD:214653 26/71 (37%)
Ig2_RPTP_IIa_LAR_like 152..226 CDD:143215 25/69 (36%)
IG_like 242..319 CDD:214653
Ig3_RPTP_IIa_LAR_like 250..318 CDD:143216
FN3 323..412 CDD:238020
FN3 419..511 CDD:238020
FN3 516..604 CDD:238020
FN3 612..706 CDD:238020
FN3 714..819 CDD:238020
FN3 929..1017 CDD:238020
FN3 1022..1105 CDD:238020
PTPc 1364..1619 CDD:214550
PTPc 1390..1619 CDD:238006
PTPc 1651..1910 CDD:214550
PTPc 1680..1910 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000235
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.