DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7607 and Ptprd

Sequence 1:NP_648449.1 Gene:CG7607 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_017175535.1 Gene:Ptprd MGIID:97812 Length:1980 Species:Mus musculus

Alignment Length:71 Identity:25/72 (35%)
Similarity:33/72 (46%) Gaps:4/72 (6%)


  Fly    83 RKITFFCMAQGNPRPTITWFKD----GAELYQHRFFQVHESHIEANIVKSKMEIDPTTQMDAGFY 143
            |..|..|.|.|||.|.||||||    .......|..|:....|....::..::|:.:.:.|.|.|
Mouse   149 RTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKY 213

  Fly   144 ECQADN 149
            ||.|.|
Mouse   214 ECVATN 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7607NP_648449.1 Ig 85..159 CDD:143165 24/70 (34%)
PtprdXP_017175535.1 I-set 31..123 CDD:254352
Ig 48..123 CDD:299845
IG_like 140..233 CDD:214653 25/72 (35%)
Ig2_RPTP_IIa_LAR_like 151..234 CDD:143215 24/70 (34%)
IG_like 250..327 CDD:214653
Ig3_RPTP_IIa_LAR_like 258..326 CDD:143216
FN3 331..420 CDD:238020
FN3 427..519 CDD:238020
FN3 524..612 CDD:238020
fn3 620..707 CDD:278470
FN3 721..827 CDD:238020
FN3 832..927 CDD:238020
FN3 930..1021 CDD:238020
FN3 1031..>1092 CDD:238020
PTPc 1424..1679 CDD:214550
PTPc 1450..1679 CDD:238006
PTPc 1711..1970 CDD:214550
PTPc 1740..1970 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000235
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.