DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7607 and oig-1

Sequence 1:NP_648449.1 Gene:CG7607 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_498439.1 Gene:oig-1 WormBaseID:WBGene00003859 Length:137 Species:Caenorhabditis elegans

Alignment Length:158 Identity:53/159 (33%)
Similarity:75/159 (47%) Gaps:41/159 (26%)


  Fly    13 LLCLCFLIFGDLIYIAAQRSTAGKTERRNYTGKKPVVIQHRSQDAVNYYDHENGA-KIIKSSHFE 76
            :|.||||..|    |.|:.|..                     :.:::.||.||: ||.:||:|:
 Worm    11 ILLLCFLSVG----INAKSSHI---------------------EDLDFTDHTNGSPKISRSSYFK 50

  Fly    77 LDYTLGRKITFFCMAQGNPRPTITWFKDGAELYQHRFFQVHESH-------IEANIVKSKMEIDP 134
            .|:.||.|:..||.:.|||||.|.|:        ||..:|:..|       |..:.|.|.:|:||
 Worm    51 QDFRLGYKLKLFCESSGNPRPQIVWY--------HRGVEVNPDHNRTIRFSIHGDTVSSHLEVDP 107

  Fly   135 TTQMDAGFYECQADNIYAIDRRGFRTDY 162
            |:..|.|.|||.|.|:.....:.|.|||
 Worm   108 TSIGDKGEYECVATNLKGSRVKKFLTDY 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7607NP_648449.1 Ig 85..159 CDD:143165 28/81 (35%)
oig-1NP_498439.1 Ig 59..131 CDD:143165 27/80 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C1RV
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1418131at2759
OrthoFinder 1 1.000 FOG0000235
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R17061
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.