DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7607 and ptp-3

Sequence 1:NP_648449.1 Gene:CG7607 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001263671.1 Gene:ptp-3 WormBaseID:WBGene00004215 Length:2248 Species:Caenorhabditis elegans

Alignment Length:67 Identity:19/68 (28%)
Similarity:32/68 (47%) Gaps:5/68 (7%)


  Fly    84 KITFFCMAQGNPRPTITWFKDGAELYQHRFFQVHESHIEANIVK-SKMEIDPTTQMDAGFYECQA 147
            ||:|||.|.|||.|::.|..:|..:..|....:.......:.:: .::.:|.    :|....|.|
 Worm   108 KISFFCRADGNPLPSVIWRVNGKSITDHNRISIKSLATGLSTLRFERVSLDD----NATVVSCSA 168

  Fly   148 DN 149
            ||
 Worm   169 DN 170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7607NP_648449.1 Ig 85..159 CDD:143165 18/67 (27%)
ptp-3NP_001263671.1 I-set 93..184 CDD:254352 19/68 (28%)
Ig 106..185 CDD:299845 19/68 (28%)
IG_like 201..287 CDD:214653
Ig 212..288 CDD:299845
IG_like 302..378 CDD:214653
Ig 309..377 CDD:299845
FN3 383..499 CDD:238020
FN3 507..600 CDD:238020
FN3 605..693 CDD:238020
FN3 700..813 CDD:238020
FN3 818..918 CDD:238020
FN3 923..1020 CDD:238020
FN3 1027..1116 CDD:238020
fn3 1125..1213 CDD:278470
PTPc 1694..1949 CDD:214550
PTPc 1720..1949 CDD:238006
PTPc 1980..2239 CDD:214550
PTPc 2008..2239 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000235
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.