DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7607 and F55F8.7

Sequence 1:NP_648449.1 Gene:CG7607 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_491657.2 Gene:F55F8.7 WormBaseID:WBGene00018895 Length:491 Species:Caenorhabditis elegans

Alignment Length:132 Identity:27/133 (20%)
Similarity:40/133 (30%) Gaps:38/133 (29%)


  Fly    36 KTERRNYTGKKPVVIQHRSQDAVNYYDHENGAKIIKSSHFELDYTLGRKITFFCMAQGNPRPTIT 100
            |.|:.....|:..:.:..|.|..|....|.|:                          :||.  .
 Worm   131 KKEKSKKVNKEKKISKTESDDEDNEQPPEPGS--------------------------DPRK--I 167

  Fly   101 WFKDGAELYQHRFFQVHESHIEANIVKSKMEIDPTTQMDAGFYECQAD-NIYAIDRRGFRTDYVM 164
            |....|::......::|:.       |.|..:.|.....|  ||...| |.||..|....|..|:
 Worm   168 WAFKAAKMKCQAISKLHQD-------KIKGYMPPNCTYTA--YEANPDLNRYADVRCIEETRVVL 223

  Fly   165 VN 166
            .|
 Worm   224 KN 225

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7607NP_648449.1 Ig 85..159 CDD:143165 16/75 (21%)
F55F8.7NP_491657.2 PTPc 193..437 CDD:214550 12/36 (33%)
PTPc 206..437 CDD:238006 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000235
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.